Overview

  • Product name

  • Description

    Rabbit polyclonal to Elongin A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Elongin A aa 200-344. Expressed in E.coli.
    Sequence:

    QEPIVSHPKPGKVHSNTFQDRLGVSHLGEHQGKGAVSQNKPHKSSHKEKR PVDARGDEKSSVMGREKSHKASSKEESRRLLSEDSAKEKLPSSVVKKEKD REGNSLKKKLSPALDVASDNHFKKPKHKDSEKIKSDKNKQSVDSV


    Database link: Q63187

  • Positive control

    • WB: Recombinant rat Elongin A; mouse cerebrum and liver tissue lysate. IHC-P: Rat heart, skeletal muscle, liver and spinal cord tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 87 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 1 TFIIS N-terminal domain.
  • Domain

    The elongin BC complex binding domain is also known as BC-box with the consensus [APST]-L-x(3)-C-x(3)-[AILV].
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ela1 antibody
    • Elo A antibody
    • EloA antibody
    • ELOA1_HUMAN antibody
    • Elongin 110 kDa subunit antibody
    • Elongin-A antibody
    • ElonginA antibody
    • RNA polymerase II transcription factor SIII subunit A1 antibody
    • SIII antibody
    • SIII p110 antibody
    • TCEB 3 antibody
    • Tceb3 antibody
    • TCEB3A antibody
    • Transcription elongation factor B (SIII) polypeptide 3 (110kD) antibody
    • Transcription elongation factor B (SIII) polypeptide 3 antibody
    • Transcription elongation factor B alpha subunit antibody
    • Transcription elongation factor B polypeptide 3 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat heart tissue stained for Elongin A using ab231980 at 20 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded rat skeletal muscle tissue stained for Elongin A using ab231980 at 20 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for Elongin A using ab231980 at 20 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for Elongin A using ab231980 at 20 μg/ml in immunohistochemical analysis.

  • Anti-Elongin A antibody (ab231980) at 2 µg/ml + Recombinant rat Elongin A protein

    Developed using the ECL technique.

    Predicted band size: 87 kDa

  • Anti-Elongin A antibody (ab231980) at 2 µg/ml + Mouse cerebrum tissue lysate

    Developed using the ECL technique.

    Predicted band size: 87 kDa

  • Anti-Elongin A antibody (ab231980) at 2 µg/ml + Mouse liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 87 kDa

References

ab231980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up