Overview

  • Product name

  • Description

    Rabbit polyclonal to ELOVL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Cynomolgus monkey, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human ELOVL4 aa 270-314.
    Sequence:

    YKEPKKPKAGKTAMNGISANGVSKSEKQLMIENGKKQKNGKAKGD


    Database link: Q9GZR5

  • Positive control

    • WB: HepG2 cell lysate; rat heart and liver tissue lysate. IHC: Human testis and small intestine tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 37 kDa (predicted molecular weight: 37 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs). Elongates C24:0 and C26:0 acyl-CoAs. Seems to represent a photoreceptor-specific component of the fatty acid elongation system residing on the endoplasmic reticulum. May be implicated in docosahexaenoic acid (DHA) biosynthesis, which requires dietary consumption of the essential alpha-linolenic acid and a subsequent series of three elongation steps.
  • Tissue specificity

    Expressed in the retina and at much lower level in the brain. Ubiquitous, highest expression in thymus, followed by testis, small intestine, ovary, and prostate. Little or no espression in heart, lung, liver, or leukocates.
  • Involvement in disease

    Defects in ELOVL4 are the cause of Stargardt disease type 3 (STGD3) [MIM:600110]. STGD is one of the most frequent causes of macular degeneration in childhood. It is characterized by macular dystrophy with juvenile-onset, rapidly progressive course, alterations of the peripheral retina, and subretinal deposition of lipofuscin-like material. STGD3 inheritance is autosomal dominant.
  • Sequence similarities

    Belongs to the ELO family.
  • Domain

    The di-lysine motif may confer endoplasmic reticulum localization.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

    see all
  • Alternative names

    • 3-keto acyl-CoA synthase ELOVL4 antibody
    • ADMD antibody
    • Cancer/testis antigen 118 antibody
    • CT118 antibody
    • Elongation of very long chain fatty acids (FEN1/Elo2 SUR4/Elo3 yeast) like 4 antibody
    • Elongation of very long chain fatty acids like 4 antibody
    • Elongation of very long chain fatty acids protein 4 antibody
    • ELOV L4 antibody
    • ELOV4_HUMAN antibody
    • ELOVL 4 antibody
    • ELOVL4 antibody
    • FLJ17667 antibody
    • FLJ92876 antibody
    • Stargardt disease 3 antibody
    • Stargardt disease 3 autosomal dominant antibody
    • STGD 2 antibody
    • STGD 3 antibody
    • STGD2 antibody
    • STGD3 antibody
    see all

Images

  • All lanes : Anti-ELOVL4 antibody (ab224608) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : Rat heart lysate
    Lane 3 : Rat liver lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 37 kDa
    Observed band size: 37 kDa



    Blocking: 5% milk (non-fat dry milk dissolved in PBST) incubate overnight under 4 oC.
    Primary antibody incubation: Dilute primary antibody with 5% milk (non-fat dry milk dissolved in PBST), incubate overnight at 4oC.
    Washing: PBST, 4 times, 10 minutes.
    Secondary antibody incubation: Dilute secondary antibody at 1/10000 or 1/20000 with 5% milk (non-fat dry milk dissolved in PBST), incubate for 1 hour under 25oC.
    Washing: PBST, 4 times, 10 minutes.

  • Paraffin-embedded human testis tissue stained for ELOVL4 using ab224608 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for ELOVL4 using ab224608 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ELOVL4 (green) using ab224608 at 1/100 dilution in ICC/IF.

    Secondary antibody: Alexa Fluor® 488-congugated AffiniPure Goat Anti-Rabbit IgG (H+L).

References

ab224608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up