Overview

  • Product name

    Anti-Emerin antibody [8F5A8]
    See all Emerin primary antibodies
  • Description

    Mouse monoclonal [8F5A8] to Emerin
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Emerin aa 1-222. Expressed in E. coli.
    Sequence:

    MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSP PSSSAASSYSFSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYF TTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLLSSSEEECKDR ERPMYGRDSAYQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSW LTRRAIRPENRAPGAGLGQDRQ


    Database link: P50402

  • Positive control

    • HeLa, A549 and K562 cells. Human ovarian cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    8F5A8
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/400.
ICC/IF 1/200 - 1/1000.
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 29 kDa.

Target

  • Function

    Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in the nucleus. Acts by influencing the nuclear accumulation of beta-catenin through a CRM1-dependent export pathway. Links centrosomes to the nuclear envelope via a microtubule association. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. Required for proper localization of non-farnesylated prelamin-A/C.
  • Tissue specificity

    Skeletal muscle, heart, colon, testis, ovary and pancreas.
  • Involvement in disease

    Defects in EMD are the cause of Emery-Dreifuss muscular dystrophy type 1 (EDMD1) [MIM:310300]. A degenerative myopathy characterized by weakness and atrophy of muscle without involvement of the nervous system, early contractures of the elbows Achilles tendons and spine, and cardiomyopathy associated with cardiac conduction defects.
  • Sequence similarities

    Contains 1 LEM domain.
  • Post-translational
    modifications

    Found in four different phosphorylated forms, three of which appear to be associated with the cell cycle.
  • Cellular localization

    Nucleus inner membrane. Nucleus outer membrane. Colocalized with BANF1 at the central region of the assembling nuclear rim, near spindle-attachment sites. The accumulation of different intermediates of prelamin-A/C (non-farnesylated or carboxymethylated farnesylated prelamin-A/C) in fibroblasts modify its localization in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • EDMD antibody
    • Emd antibody
    • EMD_HUMAN antibody
    • Emerin antibody
    • Emery Dreifuss muscular dystrophy antibody
    • STA antibody
    see all

Images

  • Lane 1: Wild-type HAP1 whole cell lysate (20 µg)
    Lane 2: Emerin knockout HAP1 whole cell lysate (20 µg)
    Lane 3: HeLa whole cell lysate (20 µg)

    Lanes 1 - 3: Merged signal (red and green). Green - ab204987 observed at 34 kDa. Red - loading control, ab181602, observed at 37 kDa.

    ab204987 was shown to recognize Emerin in wild-type HAP1 cells as signal was lost at the expected MW in Emerin knockout cells. Additional cross-reactive bands were observed in the wild-type and knockout cells. Wild-type and Emerin knockout samples were subjected to SDS-PAGE. Ab204987 and ab181602 (Rabbit anti-GAPDH loading control) were incubated overnight at 4°C at 1/1000 dilution and 1/20000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed ab216772 and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed ab216777 secondary antibodies at 1/10000 dilution for 1 hour at room temperature before imaging.

  • Immunofluorescence analysis of HeLa cells, labeling Emerin with ab204987 at a 1/200 dilution.

  • Flow Cytometry analysis of A549 cells, labeling Emerin with ab204987 at a 1/200 dilution (green) and negative control (red).

  • Flow Cytometry analysis of K562 cells, labeling Emerin with ab204987 at a 1/200 dilution (green) and negative control (red).

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded Human ovarian cancer sections labeling Emerin with ab204987 at a 1/200 dilution.

  • Anti-Emerin antibody [8F5A8] (ab204987) at 1/500 dilution + immunogen

    Predicted band size: 29 kDa

  • All lanes : Anti-Emerin antibody [8F5A8] (ab204987) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Immunogen-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 29 kDa

References

ab204987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (U2OS)
Permeabilization
Yes - NP40
Specification
U2OS
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 21°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Aug 16 2019

Application
Western blot
Sample
Human Cell lysate - nuclear (Vascular smooth muscle cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
20 µg
Specification
Vascular smooth muscle cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 1`°C

Abcam user community

Verified customer

Submitted Aug 12 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up