Overview

  • Product name

  • Description

    Rabbit polyclonal to EMILIN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat EMILIN1 aa 684-899. (Expressed in E.coli).
    Sequence:

    LEDRLQQLSLKDFTGPSGKAGPPGPPGLQGPPGPAGPPGPPGKDGQRGAI GPPGPQGEQGVEGAPAAPVPRVAFSAALSLPRSEPGTVPFDRVLLNDGGY YDPETGVFTAPLAGRYLLSAVLTGHRHEKVEAVLSRSNLGVARIDSGGYE PEGLENKPVAESQPSPGALGVFSLILPLQVGDTVCIDLVMGQLAHSEEPL TIFSGALLYEDTDLEQ


    Database link: D3Z9E1

  • Positive control

    • IHC-P: Rat spleen tissue. WB: Rat serum; Rat intestine lysate; Recombinant rat EMILIN1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 94 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May be responsible for anchoring smooth muscle cells to elastic fibers, and may be involved not only in the formation of the elastic fiber, but also in the processes that regulate vessel assembly. Has cell adhesive capacity.
  • Tissue specificity

    Distributed in tissues where resilience and elastic recoil are prominent. Highest levels in the adult small intestine, aorta, lung, uterus, and appendix and in the fetal spleen, kidney, lung, and heart; intermediate expression was detected in adult liver, ovary, colon, stomach, lymph node and spleen; adult heart, bladder, prostate, adrenal gland, mammary gland, placenta and kidney showed low expression whereas a series of other adult tissues, including skeletal muscle and different regions of adult brain show no expression.
  • Sequence similarities

    Contains 1 C1q domain.
    Contains 1 collagen-like domain.
    Contains 1 EMI domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix. Found mainly at the interface between amorphous elastin and microfibrils.
  • Information by UniProt
  • Database links

  • Alternative names

    • Elastin microfibril interface located protein 1 antibody
    • Elastin microfibril interface located protein antibody
    • Elastin microfibril interface-located protein 1 antibody
    • Elastin microfibril interfacer 1 antibody
    • EMIL1_HUMAN antibody
    • EMILIN 1 antibody
    • EMILIN antibody
    • EMILIN-1 antibody
    • Emilin1 antibody
    • gp115 antibody
    see all

Images

  • Paraffin-embedded rat spleen tissue stained for EMILIN1 using ab231052 at 20 µg/ml in immunohistochemical analysis, followed by DAB staining.

  • Paraffin-embedded rat spleen tissue stained for EMILIN1 using ab231052 at 20 µg/ml in immunohistochemical analysis, followed by DAB staining.

  • All lanes : Anti-EMILIN1 antibody (ab231052) at 3 µg/ml

    Lane 1 : Rat serum
    Lane 2 : Rat intestine lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit antibody at 1/2000 dilution

    Predicted band size: 94 kDa

  • Anti-EMILIN1 antibody (ab231052) at 3 µg/ml + Recombinant rat EMILIN1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit antibody at 1/2000 dilution

    Predicted band size: 94 kDa

References

ab231052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up