Anti-EMP2 antibody (ab223718)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-EMP2 antibody
See all EMP2 primary antibodies -
Description
Rabbit polyclonal to EMP2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee -
Immunogen
Recombinant fragment corresponding to Human EMP2 aa 25-60.
Sequence:DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
Database link: P54851 -
Positive control
- IHC-P: Human lung tissue. WB: MCF7 cell lysate. ICC/IF: U-251 MG cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab223718 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | 1/250 - 1/500. Predicted molecular weight: 19 kDa. |
Target
-
Sequence similarities
Belongs to the PMP-22/EMP/MP20 family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 453910 Chimpanzee
- Entrez Gene: 2013 Human
- Omim: 602334 Human
- SwissProt: A5A6N6 Chimpanzee
- SwissProt: P54851 Human
- Unigene: 531561 Human
-
Alternative names
- EMP 2 antibody
- EMP-2 antibody
- EMP2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EMP2 antibody (ab223718)
Paraffin-embedded human lung tissue stained for EMP2 using ab223718 at 1/50 dilution in immunohistochemical analysis.
-
Anti-EMP2 antibody (ab223718) at 1/250 dilution + MCF7 (human breast adenocarcinoma cell line) cell lysate
Predicted band size: 19 kDa -
PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for EMP2 (green) using ab223718 at 4 µg/ml in ICC/IF.
Protocols
Datasheets and documents
References
ab223718 has not yet been referenced specifically in any publications.