Anti-EMP2 antibody (ab223718)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to EMP2
  • Suitable for: ICC/IF, IHC-P, WB
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-EMP2 antibody
    See all EMP2 primary antibodies

  • Description

    Rabbit polyclonal to EMP2

  • Host species

    Rabbit

  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee

  • Immunogen

    Recombinant fragment corresponding to Human EMP2 aa 25-60.
    Sequence:

    DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST


    Database link: P54851

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Human lung tissue. WB: MCF7 cell lysate. ICC/IF: U-251 MG cells.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab223718 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 19 kDa.

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EMP2 antibody (ab223718)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EMP2 antibody (ab223718)

    Paraffin-embedded human lung tissue stained for EMP2 using ab223718 at 1/50 dilution in immunohistochemical analysis.

  • Western blot - Anti-EMP2 antibody (ab223718)
    Western blot - Anti-EMP2 antibody (ab223718)
    Anti-EMP2 antibody (ab223718) at 1/250 dilution + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 19 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-EMP2 antibody (ab223718)
    Immunocytochemistry/ Immunofluorescence - Anti-EMP2 antibody (ab223718)

    PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for EMP2 (green) using ab223718 at 4 µg/ml in ICC/IF.

References (0)

Publishing research using ab223718? Please let us know so that we can cite the reference in this datasheet.

ab223718 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab223718.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com