Overview

  • Product name
    Anti-EMP2 antibody - C-terminal
    See all EMP2 primary antibodies
  • Description
    Rabbit polyclonal to EMP2 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human EMP2 aa 99-129 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    QGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAK


    Database link: P54851

  • Positive control
    • Human skin tissue (epidermis), Mouse lung tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab174699 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB 1/100 - 1/500. Predicted molecular weight: 19 kDa.

Target

Images

  • Immunohistochemical analysis of formalin fixed, paraffin-embedded Human skin (epidermis) tissue, labeling EMP2 with ab174699 at 10 µg/ml.

  • Anti-EMP2 antibody - C-terminal (ab174699) at 1/100 dilution + Mouse lung tissue lysate at 35 µg

    Predicted band size: 19 kDa

References

ab174699 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174699.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up