Anti-EMP2 antibody - C-terminal (ab174699)
Key features and details
- Rabbit polyclonal to EMP2 - C-terminal
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-EMP2 antibody - C-terminal
See all EMP2 primary antibodies -
Description
Rabbit polyclonal to EMP2 - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide within Human EMP2 aa 99-129 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:QGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAK
Database link: P54851 -
Positive control
- Human skin tissue (epidermis), Mouse lung tissue lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab174699 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 10 µg/ml. | |
WB | 1/100 - 1/500. Predicted molecular weight: 19 kDa. |
Target
-
Sequence similarities
Belongs to the PMP-22/EMP/MP20 family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 2013 Human
- Entrez Gene: 13731 Mouse
- Omim: 602334 Human
- SwissProt: P54851 Human
- SwissProt: O88662 Mouse
- Unigene: 531561 Human
- Unigene: 246009 Mouse
-
Alternative names
- EMP 2 antibody
- EMP-2 antibody
- EMP2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EMP2 antibody - C-terminal (ab174699)
Immunohistochemical analysis of formalin fixed, paraffin-embedded Human skin (epidermis) tissue, labeling EMP2 with ab174699 at 10 µg/ml.
-
Anti-EMP2 antibody - C-terminal (ab174699) at 1/100 dilution + Mouse lung tissue lysate at 35 µg
Predicted band size: 19 kDa
Protocols
Datasheets and documents
References (0)
ab174699 has not yet been referenced specifically in any publications.