Anti-EMP2 antibody - C-terminal (ab174699)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-EMP2 antibody - C-terminal
See all EMP2 primary antibodies -
DescriptionRabbit polyclonal to EMP2 - C-terminal
-
Host speciesRabbit
-
Tested applicationsSuitable for: IHC-P, WBmore details
-
Species reactivityReacts with: Mouse, Human
-
Immunogen
Synthetic peptide within Human EMP2 aa 99-129 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
Sequence:QGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAK
Database link: P54851 -
Positive control
- Human skin tissue (epidermis), Mouse lung tissue lysate.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
-
Storage bufferPreservative: 0.09% Sodium azide
Constituent: 99% PBS -
Concentration information loading... -
PurityImmunogen affinity purified
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab174699 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 10 µg/ml. | |
| WB | 1/100 - 1/500. Predicted molecular weight: 19 kDa. |
Target
-
Sequence similaritiesBelongs to the PMP-22/EMP/MP20 family.
-
Cellular localizationMembrane.
- Information by UniProt
-
Database links
- Entrez Gene: 2013 Human
- Entrez Gene: 13731 Mouse
- Omim: 602334 Human
- SwissProt: P54851 Human
- SwissProt: O88662 Mouse
- Unigene: 531561 Human
- Unigene: 246009 Mouse
-
Alternative names
- EMP 2 antibody
- EMP-2 antibody
- EMP2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EMP2 antibody - C-terminal (ab174699)Immunohistochemical analysis of formalin fixed, paraffin-embedded Human skin (epidermis) tissue, labeling EMP2 with ab174699 at 10 µg/ml.
-
Western blot - Anti-EMP2 antibody - C-terminal (ab174699)Anti-EMP2 antibody - C-terminal (ab174699) at 1/100 dilution + Mouse lung tissue lysate at 35 µg
Predicted band size: 19 kDa
Datasheets and documents
References
ab174699 has not yet been referenced specifically in any publications.
