Overview

  • Product name

  • Description

    Rabbit polyclonal to EMP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human EMP3 aa 25-65.
    Sequence:

    DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKA


    Database link: P54852

  • Positive control

    • WB: Mouse heart tissue lysate. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236671 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

Images

  • Anti-EMP3 antibody (ab236671) at 1/1000 dilution + Mouse heart tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling EMP3 using ab236671 at 1/100 dilution in ICC/IF. Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L) was used as the secondary antibody.

References

ab236671 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236671.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up