Overview

  • Product name

  • Description

    Rabbit polyclonal to Emx1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Emx1 aa 76-162.
    Sequence:

    RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHF YPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI


    Database link: Q04741

  • Positive control

    • IHC-P: Human kidney tissue; mouse E11 embryonic brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.
  • Tissue specificity

    Cerebral cortex.
  • Sequence similarities

    Belongs to the EMX homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Empty spiracles homeobox 1 antibody
    • Empty spiracles homolog 1 antibody
    • empty spiracles homolog 1 Drosophila antibody
    • Empty spiracles like protein 1 antibody
    • Empty spiracles-like protein 1 antibody
    • EMX1 antibody
    • EMX1_HUMAN antibody
    • Homeobox protein EMX1 antibody
    see all

Images

  • Paraffin-embedded mouse E11 embryonic brain tissue stained for Emx1 with ab224343  (1/50) in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for Emx1 with ab224343 (1/50) in immunohistochemical analysis.

References

ab224343 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up