Anti-EMX2 antibody (ab171818)
Key features and details
- Mouse polyclonal to EMX2
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-EMX2 antibody
See all EMX2 primary antibodies -
Description
Mouse polyclonal to EMX2 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Full length protein corresponding to Human EMX2 aa 1-252. (NP_004089.1)
Sequence:MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNG FHSAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLP SSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNAL ARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV WFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTS DD
Database link: Q04743 -
Positive control
- EMX2 transfected 293T cell line lysate
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab171818 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa. |
Target
-
Function
Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system. -
Tissue specificity
Cerebral cortex. -
Involvement in disease
Defects in EMX2 are the cause of schizencephaly (SCHZC) [MIM:269160]. Schizencephaly is an extremely rare human congenital disorder characterized by a full-thickness cleft within the cerebral hemispheres. These clefts are lined with gray matter and most commonly involve the parasylvian regions. Large portions of the cerebral hemispheres may be absent and replaced by cerebro-spinal fluid. -
Sequence similarities
Belongs to the EMX homeobox family.
Contains 1 homeobox DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 2018 Human
- Omim: 600035 Human
- SwissProt: Q04743 Human
- Unigene: 202095 Human
-
Alternative names
- Empty spiracles homeobox 2 antibody
- Empty spiracles homolog 2 (Drosophila) antibody
- Empty spiracles homolog 2 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab171818 has not yet been referenced specifically in any publications.