Sample Prep & Detection Kits
Conjugation kitsPurification kitsSample preparation kitsChromogen kitsIHC kitsChIP kitsAccessory Reagents & Controls
Accessory reagents & controlsBiochemicals
BiochemicalsProteins and Peptides
Proteins and peptidesOur latest ELISA kit: Human Tau (phospho T217) - Intracellular
Highly sensitive kit offering the most promising biomarkers for Alzheimer’s disease diagnostics. Learn about all product ranges with our product overviews.
Featured events
Make new connections at our global events.
Our programs
New Lab Program
Get a head start with our exclusive new lab discount. Enjoy 20% off and free shipping for three months.
New Biotech Program
Just starting out? Get 15% off and free shipping to your lab for six months.
Product promise
Peace of mind that all products perform as stated.
Product reviews
Leave reviews, get rewarded and help your community.
Trial program
Try untested species and applications to earn money off your next order.
Mouse Monoclonal BCL10 antibody. Suitable for IHC-P and reacts with Human samples. Immunogen corresponding to Recombinant Full Length Protein corresponding to Human BCL10.
Alternative names=B-cell lymphoma/leukemia 10, B-cell CLL/lymphoma 10, CARD-containing molecule enhancing NF-kappa-B, CARD-like apoptotic protein, CED-3/ICH-1 prodomain homologous E10-like regulator, Cellular homolog of vCARMEN, Cellular-E10, Mammalian CARD-containing adapter molecule E10, Bcl-10, hCLAP, CIPER, cCARMEN, c-E10, mE10, CLAP, CIPER, BCL10
IgG1
Mouse
pH: 7.2 - 7.4
Preservative: 0.05% Sodium azide
Constituents: PBS, 0.05% BSA
Liquid
Monoclonal
Recombinant Full Length Protein corresponding to Human BCL10. Database link: O95999
IHC-P | |
---|---|
Human | Tested |
Species | Dilution info | Notes |
---|---|---|
Species Human | Dilution info 0.50000-1.00000 µg/mL | Notes Primary incubation for 30 minutes at room temperature. Perform heat-mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Mouse Monoclonal BCL10 antibody. Suitable for IHC-P and reacts with Human samples. Immunogen corresponding to Recombinant Full Length Protein corresponding to Human BCL10.
Alternative names=B-cell lymphoma/leukemia 10, B-cell CLL/lymphoma 10, CARD-containing molecule enhancing NF-kappa-B, CARD-like apoptotic protein, CED-3/ICH-1 prodomain homologous E10-like regulator, Cellular homolog of vCARMEN, Cellular-E10, Mammalian CARD-containing adapter molecule E10, Bcl-10, hCLAP, CIPER, cCARMEN, c-E10, mE10, CLAP, CIPER, BCL10
IgG1
Mouse
pH: 7.2 - 7.4
Preservative: 0.05% Sodium azide
Constituents: PBS, 0.05% BSA
Liquid
Monoclonal
Recombinant Full Length Protein corresponding to Human BCL10. Database link: O95999
SPM520
Affinity purification Protein A/G
Amino acids 122-168 (CEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFST)
kappa
Ab purified from Bioreactor Concentrate by Protein A/G.
Blue Ice
1-2 weeks
+4°C
-20°C
Upon delivery aliquot
Avoid freeze / thaw cycle
Abcam is leading the way to address reproducibility in scientific research with our highly validated recombinant monoclonal and recombinant multiclonal antibodies. Search & select one of Abcam's thousands of recombinant alternatives to eliminate batch-variability and unnecessary animal use.
If you do not find a host species to meet your needs, our catalogue and custom Chimeric range provides scientists the specificity of Abcam's RabMAbs in the species backbone of your choice. Remember to also review our range of edited cell lines, proteins and biochemicals relevant to your target that may help you further your research goals.
Abcam antibodies are extensively validated in a wide range of species and applications, so please check the reagent specifications meet your scientific needs before purchasing. If you have any questions or bespoke requirements, simply visit the Contact Us page to send us an inquiry or contact our Support Team ahead of purchase.
We have tested this species and application combination and it works. It is covered by our product promise.
We have not tested this specific species and application combination in-house, but expect it will work. It is covered by our product promise.
This species and application combination has not been tested, but we predict it will work based on strong homology. However, this combination is not covered by our product promise.
We do not recommend this combination. It is not covered by our product promise.
We are dedicated to supporting your work with high quality reagents and we are here for you every step of the way should you need us.
In the unlikely event of one of our products not working as expected, you are covered by our product promise.
Full details and terms and conditions can be found here:
Terms & Conditions.
Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.
For licensing inquiries, please contact partnerships@abcam.com