Products
Sample Prep & Detection Kits
Conjugation kitsPurification kitsSample preparation kitsChromogen kitsIHC kitsChIP kitsAccessory Reagents & Controls
Accessory reagents & controlsBiochemicals
BiochemicalsProteins and Peptides
Proteins and peptidesOur latest ELISA kit: Human Tau (phospho T217) - Intracellular
Highly sensitive kit offering the most promising biomarkers for Alzheimer’s disease diagnostics. Learn about all product ranges with our product overviews.
Resources
Featured events
Make new connections at our global events.
Support
Our programs
New Lab Program
Get a head start with our exclusive new lab discount. Enjoy 20% off and free shipping for three months.
New Biotech Program
Just starting out? Get 15% off and free shipping to your lab for six months.
Product promise
Peace of mind that all products perform as stated.
Product reviews
Leave reviews, get rewarded and help your community.
Trial program
Try untested species and applications to earn money off your next order.
Mouse Monoclonal BCL10 antibody. Carrier free. Suitable for IHC-P and reacts with Human samples. Immunogen corresponding to Recombinant Full Length Protein corresponding to Human BCL10.
Alternative names=B-cell lymphoma/leukemia 10, B-cell CLL/lymphoma 10, CARD-containing molecule enhancing NF-kappa-B, CARD-like apoptotic protein, CED-3/ICH-1 prodomain homologous E10-like regulator, Cellular homolog of vCARMEN, Cellular-E10, Mammalian CARD-containing adapter molecule E10, Bcl-10, hCLAP, CIPER, cCARMEN, c-E10, mE10, CLAP, CIPER, BCL10
- Isotype
IgG1
- Host species
Mouse
- Storage buffer
pH: 7.2 - 7.4
Constituents: 100% PBS- Form
Liquid
- Clonality
Monoclonal
- Immunogen
Recombinant Full Length Protein corresponding to Human BCL10. Database link: O95999
Reactivity data
Select an application| IHC-P | |
|---|---|
| Human | Tested |
Images
IHC-P
TestedTested
| Species | Dilution info | Notes |
|---|---|---|
Species Human | Dilution info 0.5-1 µg/mL | Notes Primary incubation for 30 minutes at room temperature. Perform heat-mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target data
Function
Plays a key role in both adaptive and innate immune signaling by bridging CARD domain-containing proteins to immune activation (PubMed:10187770, PubMed:10364242, PubMed:10400625, PubMed:25365219, PubMed:24074955). Acts by channeling adaptive and innate immune signaling downstream of CARD domain-containing proteins CARD9, CARD11 and CARD14 to activate NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines (PubMed:24074955). Recruited by activated CARD domain-containing proteins: homooligomerized CARD domain-containing proteins form a nucleating helical template that recruits BCL10 via CARD-CARD interaction, thereby promoting polymerization of BCL10, subsequent recruitment of MALT1 and formation of a CBM complex (PubMed:24074955). This leads to activation of NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines (PubMed:18287044, PubMed:27777308, PubMed:24074955). Activated by CARD9 downstream of C-type lectin receptors; CARD9-mediated signals are essential for antifungal immunity (PubMed:26488816). Activated by CARD11 downstream of T-cell receptor (TCR) and B-cell receptor (BCR) (PubMed:18264101, PubMed:18287044, PubMed:27777308, PubMed:24074955). Promotes apoptosis, pro-caspase-9 maturation and activation of NF-kappa-B via NIK and IKK (PubMed:10187815).
Recommended products
Mouse Monoclonal BCL10 antibody. Carrier free. Suitable for IHC-P and reacts with Human samples. Immunogen corresponding to Recombinant Full Length Protein corresponding to Human BCL10.
Alternative names=B-cell lymphoma/leukemia 10, B-cell CLL/lymphoma 10, CARD-containing molecule enhancing NF-kappa-B, CARD-like apoptotic protein, CED-3/ICH-1 prodomain homologous E10-like regulator, Cellular homolog of vCARMEN, Cellular-E10, Mammalian CARD-containing adapter molecule E10, Bcl-10, hCLAP, CIPER, cCARMEN, c-E10, mE10, CLAP, CIPER, BCL10
Key facts
- Isotype
IgG1
- Host species
Mouse
- Storage buffer
pH: 7.2 - 7.4
Constituents: 100% PBS- Form
Liquid
- Clonality
Monoclonal
- Immunogen
Recombinant Full Length Protein corresponding to Human BCL10. Database link: O95999
- Carrier free
Yes
- Clone number
SPM520
- Purification technique
Affinity purification Protein G
- Epitope
Amino acids 122-168 (CEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFST)
- Light chain type
kappa
- Concentration
- Purification notes
ab212979 was purified from Bioreactor Concentrate by Protein A/G.
Storage
- Shipped at conditions
Blue Ice
- Appropriate short-term storage duration
1-2 weeks
- Appropriate short-term storage conditions
+4°C
- Appropriate long-term storage conditions
-20°C
- Aliquoting information
Upon delivery aliquot
- Storage information
Avoid freeze / thaw cycle
Notes
Abcam is leading the way to address reproducibility in scientific research with our highly validated recombinant monoclonal and recombinant multiclonal antibodies. Search & select one of Abcam's thousands of recombinant alternatives to eliminate batch-variability and unnecessary animal use.
If you do not find a host species to meet your needs, our catalogue and custom Chimeric range provides scientists the specificity of Abcam's RabMAbs in the species backbone of your choice. Remember to also review our range of edited cell lines, proteins and biochemicals relevant to your target that may help you further your research goals.
Abcam antibodies are extensively validated in a wide range of species and applications, so please check the reagent specifications meet your scientific needs before purchasing. If you have any questions or bespoke requirements, simply visit the Contact Us page to send us an inquiry or contact our Support Team ahead of purchase.
Product promise
Tested
We have tested this species and application combination and it works. It is covered by our product promise.
Expected
We have not tested this specific species and application combination in-house, but expect it will work. It is covered by our product promise.
Predicted
This species and application combination has not been tested, but we predict it will work based on strong homology. However, this combination is not covered by our product promise.
Not recommended
We do not recommend this combination. It is not covered by our product promise.
We are dedicated to supporting your work with high quality reagents and we are here for you every step of the way should you need us.
In the unlikely event of one of our products not working as expected, you are covered by our product promise.
Full details and terms and conditions can be found here:
Terms & Conditions.
Downloads
Product protocols
- Visit the general protocols
- Visit troubleshooting
Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.
For licensing inquiries, please contact partnerships@abcam.com