JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB8985

Anti-Integrin alpha 3a antibody [29A3]

Be the first to review this product! Submit a review

|

(2 Publications)

Mouse Monoclonal Integrin alpha 3 antibody. Suitable for IHC-Fr and reacts with Human samples. Cited in 2 publications. Immunogen corresponding to Synthetic Peptide within Human ITGA3 conjugated to Keyhole Limpet Haemocyanin.

View Alternative Names

CD49c, MSK18, ITGA3, Integrin alpha-3, CD49 antigen-like family member C, FRP-2, Galactoprotein B3, VLA-3 subunit alpha, GAPB3

1 Images
Immunohistochemistry (Frozen sections) - Anti-Integrin alpha 3a antibody [29A3] (AB8985)
  • IHC-Fr

Unknown

Immunohistochemistry (Frozen sections) - Anti-Integrin alpha 3a antibody [29A3] (AB8985)

Immunohistochemistry on frozen section of human kidney

Key facts

Host species

Mouse

Clonality

Monoclonal

Clone number

29A3

Isotype

IgG1

Light chain type

kappa

Carrier free

No

Reacts with

Human

Applications

IHC-Fr

applications

Immunogen

Synthetic Peptide within Human ITGA3 conjugated to Keyhole Limpet Haemocyanin. The exact immunogen used to generate this antibody is proprietary information.

P26006

Epitope

Cytoplasmic domain of a3A Integrin. Phospho-epitope.

Specificity

29A3 recognizes specifically the cytoplasmic domain of integrin subunit α3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Species", "Dilution Info", "Notes"], "tabs": { "all-applications": {"fullname" : "All Applications", "shortname": "All Applications"}, "IHCFr" : {"fullname" : "Immunohistochemistry (Frozen sections)", "shortname":"IHC-Fr"} }, "product-promise": { "all": "all", "testedAndGuaranteed": "tested", "guaranteed": "expected", "predicted": "predicted", "notRecommended": "not-recommended" } }, "values": { "Human": { "IHCFr-species-checked": "testedAndGuaranteed", "IHCFr-species-dilution-info": "", "IHCFr-species-notes": "<p>Recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent.</p>" } } }

Product details

Background
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.

Source
29A3 is a Mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Formulation: Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.

Properties and storage information

Form
Liquid
Purification technique
Affinity purification Protein G
Storage buffer
Preservative: 0.09% Sodium azide Constituents: PBS
Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Integrin alpha 3a also known as CD49c is a transmembrane protein that forms part of the integrin family. This protein with a molecular weight of approximately 116 kDa functions mainly as a receptor facilitating cell-cell and cell-extracellular matrix interactions. Integrin alpha 3a predominantly localizes on the surface of epithelial and certain mesenchymal cells. Its expression helps mediate communication and structural integrity within various tissues influencing processes such as cell adhesion and migration.
Biological function summary

Integrin alpha 3a plays an important role in cellular signaling related to tissue development and repair. By forming a heterodimer with beta subunits particularly beta 1 integrin it participates in complex cellular processes. This heterodimerization allows integrin alpha 3a to bind specifically to types of laminins and collagens key components in basement membranes. Through these interactions it can influence cellular proliferation and differentiation which are critical in maintaining tissue architecture and regulating developmental pathways.

Pathways

Integrin alpha 3a engages in the PI3K/Akt signaling and MAPK/ERK pathways both of which are significant in promoting cell survival and proliferation. It interacts closely with proteins such as fibronectin and laminin helping to relay signals that affect cytoskeletal dynamics and cell motility. The activity of integrin alpha 3a within these signaling cascades highlights its contribution to anchoring cells to their extracellular matrix influencing their response to external mechanical and chemical cues.

Integrin alpha 3a has links to conditions such as renal fibrosis and certain cancers including breast carcinoma. Its overexpression or dysfunction can disrupt normal cell adhesion and migration contributing to tumor progression and metastatic potential. Moreover it interacts with proteins like matrix metalloproteinases (MMPs) in these contexts facilitating degradation of extracellular matrix which promotes invasive behavior in cancerous cells. Research continues to explore how modulating integrin alpha 3a activity may provide therapeutic insights into these disorders.

Product protocols

For this product, it's our understanding that no specific protocols are required. You can visit:

Target data

Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.. (Microbial infection) Integrin ITGA3 : ITGB1 may act as a receptor for R.delemar CotH7 in alveolar epithelial cells, which may be an early step in pulmonary mucormycosis disease progression.
See full target information ITGA3

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Nature cell biology 27:1725-1738 PubMed41034521

2025

Microtubule architecture connects AMOT stability to YAP/TAZ mechanotransduction and Hippo signalling.

Applications

Unspecified application

Species

Unspecified reactive species

Giada Vanni,Anna Citron,Ambela Suli,Paolo Contessotto,Robin Caire,Alessandro Gandin,Giovanna Mantovan,Francesca Zanconato,Giovanna Brusatin,Michele Di Palma,Elisa Peirano,Lisa Sofia Pozzer,Carlo Albanese,Roberto A Steiner,Michelangelo Cordenonsi,Tito Panciera,Stefano Piccolo

Scientific reports 9:19150 PubMed31844158

2019

Targeting AXL and RAGE to prevent geminin overexpression-induced triple-negative breast cancer metastasis.

Applications

Unspecified application

Species

Unspecified reactive species

Daniel Ryan,Jim Koziol,Wael M ElShamy
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com