Mouse Monoclonal Integrin alpha 3 antibody. Suitable for IHC-Fr and reacts with Human samples. Cited in 1 publication. Immunogen corresponding to Synthetic Peptide within Human ITGA3 conjugated to Keyhole Limpet Haemocyanin.
Images
![Immunohistochemistry (Frozen sections) - Anti-Integrin alpha 3a antibody [29A3] (AB8985), expandable thumbnail](https://content.abcam.com/products/images/integrin-alpha-3a-antibody-29a3-ab8985--immunohistochemistry-frozen-sections-img133948.jpg/_jcr_content/renditions/webp-475.webp "Immunohistochemistry (Frozen sections) - Anti-Integrin alpha 3a antibody [29A3] (AB8985)")
Publications
Filter by
- Scientific reports 9:191502019Targeting AXL and RAGE to prevent geminin overexpression-induced triple-negative breast cancer metastasis.Applications:Unspecified applicationReactive species:Unspecified reactive speciesDaniel Ryan et. al.PubMed 31844158
Key facts
- Isotype
- IgG1
- Host species
- Mouse
- Storage buffer
Preservative: 0.09% Sodium azide
Constituents: PBS- Form
- Liquid
- Clonality
- Monoclonal
Immunogen
- Synthetic Peptide within Human ITGA3 conjugated to Keyhole Limpet Haemocyanin. The exact immunogen used to generate this antibody is proprietary information. Database link P26006
Reactivity data
Select an application| IHC-Fr | |
|---|---|
| Human | Tested |
IHC-Fr
TestedTested
| Species | Dilution info | Notes |
|---|---|---|
Species Human | Dilution info - | Notes Recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent. |
Target data
Function
Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration. (Microbial infection) Integrin ITGA3:ITGB1 may act as a receptor for R.delemar CotH7 in alveolar epithelial cells, which may be an early step in pulmonary mucormycosis disease progression.
Alternative names
CD49c, MSK18, ITGA3, Integrin alpha-3, CD49 antigen-like family member C, FRP-2, Galactoprotein B3, VLA-3 subunit alpha, GAPB3
Recommended products
Mouse Monoclonal Integrin alpha 3 antibody. Suitable for IHC-Fr and reacts with Human samples. Cited in 1 publication. Immunogen corresponding to Synthetic Peptide within Human ITGA3 conjugated to Keyhole Limpet Haemocyanin.
Key facts
- Isotype
- IgG1
- Host species
- Mouse
- Storage buffer
Preservative: 0.09% Sodium azide
Constituents: PBS- Form
- Liquid
- Clonality
- Monoclonal
- Immunogen
- Synthetic Peptide within Human ITGA3 conjugated to Keyhole Limpet Haemocyanin. The exact immunogen used to generate this antibody is proprietary information. Database link P26006
- Clone number
- 29A3
- Purification technique
- Affinity purification Protein G
- Specificity
29A3 recognizes specifically the cytoplasmic domain of integrin subunit α3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
- Epitope
- Cytoplasmic domain of a3A Integrin. Phospho-epitope.
- Light chain type
- kappa
- Concentration
Storage
- Shipped at conditions
- Blue Ice
- Appropriate short-term storage duration
- 1-2 weeks
- Appropriate short-term storage conditions
- +4°C
- Appropriate long-term storage conditions
- -20°C
- Aliquoting information
- Upon delivery aliquot
- Storage information
- Avoid freeze / thaw cycle
Notes
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.
Source
29A3 is a Mouse monoclonal IgG1, κ antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Formulation: Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
Supplementary info
- This supplementary information is collated from multiple sources and compiled automatically.
- Activity summary
Integrin alpha 3a also known as CD49c is a transmembrane protein that forms part of the integrin family. This protein with a molecular weight of approximately 116 kDa functions mainly as a receptor facilitating cell-cell and cell-extracellular matrix interactions. Integrin alpha 3a predominantly localizes on the surface of epithelial and certain mesenchymal cells. Its expression helps mediate communication and structural integrity within various tissues influencing processes such as cell adhesion and migration.
- Biological function summary
Integrin alpha 3a plays an important role in cellular signaling related to tissue development and repair. By forming a heterodimer with beta subunits particularly beta 1 integrin it participates in complex cellular processes. This heterodimerization allows integrin alpha 3a to bind specifically to types of laminins and collagens key components in basement membranes. Through these interactions it can influence cellular proliferation and differentiation which are critical in maintaining tissue architecture and regulating developmental pathways.
- Pathways
Integrin alpha 3a engages in the PI3K/Akt signaling and MAPK/ERK pathways both of which are significant in promoting cell survival and proliferation. It interacts closely with proteins such as fibronectin and laminin helping to relay signals that affect cytoskeletal dynamics and cell motility. The activity of integrin alpha 3a within these signaling cascades highlights its contribution to anchoring cells to their extracellular matrix influencing their response to external mechanical and chemical cues.
- Associated diseases and disorders
Integrin alpha 3a has links to conditions such as renal fibrosis and certain cancers including breast carcinoma. Its overexpression or dysfunction can disrupt normal cell adhesion and migration contributing to tumor progression and metastatic potential. Moreover it interacts with proteins like matrix metalloproteinases (MMPs) in these contexts facilitating degradation of extracellular matrix which promotes invasive behavior in cancerous cells. Research continues to explore how modulating integrin alpha 3a activity may provide therapeutic insights into these disorders.
Product promise
Tested
We have tested this species and application combination and it works. It is covered by our product promise.
Expected
We have not tested this specific species and application combination in-house, but expect it will work. It is covered by our product promise.
Predicted
This species and application combination has not been tested, but we predict it will work based on strong homology. However, this combination is not covered by our product promise.
Not recommended
We do not recommend this combination. It is not covered by our product promise.
We are dedicated to supporting your work with high quality reagents and we are here for you every step of the way should you need us.
In the unlikely event of one of our products not working as expected, you are covered by our product promise.
Full details and terms and conditions can be found here:
Terms & Conditions.
1 product image
![Immunohistochemistry (Frozen sections) - Anti-Integrin alpha 3a antibody [29A3] (ab8985), expandable thumbnail](https://content.abcam.com/products/images/integrin-alpha-3a-antibody-29a3-ab8985--immunohistochemistry-frozen-sections-img133948.jpg "Immunohistochemistry (Frozen sections) - Anti-Integrin alpha 3a antibody [29A3] (ab8985)")
Immunohistochemistry (Frozen sections) - Anti-Integrin alpha 3a antibody [29A3] (ab8985)
Immunohistochemistry on frozen section of human kidney
Downloads
Product protocols
- Visit the general protocols
- Visit troubleshooting
Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.
For licensing inquiries, please contact partnerships@abcam.com