JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB282390

Mouse Interferon beta protein

Be the first to review this product! Submit a review

|

(0 Publication)

Mouse Interferon beta protein is a Mouse Full Length protein, in the 30 to 379 aa range, expressed in HEK 293 cells, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC, Mass Spec.

View Alternative Names

Ifb, Ifnb, Ifnb1, Interferon beta, IFN-beta

Key facts

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, Mass Spec, HPLC

applications

Biologically active

No

Accession

P01575

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN","proteinLength":"Full Length","predictedMolecularWeight":"19.79 kDa","actualMolecularWeight":"19.79 kDa","aminoAcidEnd":379,"aminoAcidStart":30,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P01575","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Interferon beta also known as IFN-beta or beta interferon is a type I interferon with a mass of approximately 20 kDa. It originates primarily from fibroblasts and plays an essential role in the immune response. This protein targets and binds to specific cell surface receptors initiating various antiviral states within cells. This action assists in slowing down viral replication and spread. IFN-beta's expression increases in response to viral infections making it an important component in the body's first line of defense against pathogens.
Biological function summary

Interferon beta functions as an important mediator of immune functions regulating the activity of natural killer cells and macrophages. It also boosts antigen presentation to T cells. Interferon beta belongs to the larger family of interferons which includes IFN-alpha and IFN-gamma each having distinct effects but working together to mount an effective immune response. Though it does not form part of a complex it plays a critical standalone role in immune signaling pathways.

Pathways

Interferon beta associates strongly with the JAK-STAT signaling pathway. Upon activation it interacts with receptors to phosphorylate STAT proteins mainly STAT1 and STAT2 which then dimerize and translocate to the nucleus to trigger gene expression. Another important pathway is the antiviral response where interferon beta modulates the expression of hundreds of interferon-stimulated genes. These pathways intricately involve other proteins like IFN-alpha and IFN-gamma which work synergistically to establish an effective antiviral environment.

Interferon beta shows significant implications in multiple sclerosis and hepatitis C infection. It is widely used as a therapeutic agent in managing multiple sclerosis by modulating the immune response to reduce inflammation and slow disease progression. Similarly its role in antiviral defense makes it relevant to hepatitis C infection management. In these contexts IFN-alpha and IFN-gamma are also important as they share similar antiviral and immunomodulatory functions that can complement IFN-beta's actions enhancing the treatment's efficacy.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >= 95%

General info

Function

Type I interferon cytokine that plays a key role in the innate immune response to infection, developing tumors and other inflammatory stimuli (PubMed : 10708458, PubMed : 23872679). Signals via binding to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptor, activating the canonical Jak-STAT signaling pathway resulting in transcriptional activation or repression of interferon-regulated genes that encode the effectors of the interferon response, such as antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins (By similarity). Signals mostly via binding to a IFNAR1-IFNAR2 heterodimeric receptor, but can also function with IFNAR1 alone and independently of Jak-STAT pathways (PubMed : 23872679). Elicits a wide variety of responses, including antiviral and antibacterial activities, and can regulate the development of B-cells, myelopoiesis and lipopolysaccharide (LPS)-inducible production of tumor necrosis factor (PubMed : 10708458, PubMed : 14597717). Plays a role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons : acts by promoting neuronal autophagy and alpha-synuclein clearance, thereby preventing dopaminergic neuron loss (PubMed : 26451483). IFNB1 is more potent than interferon-alpha (IFN-alpha) in inducing the apoptotic and antiproliferative pathways required for control of tumor cell growth (PubMed : 14597717).

Sequence similarities

Belongs to the alpha/beta interferon family.

Post-translational modifications

This beta interferon does not have a disulfide bond.

Product protocols

Target data

Type I interferon cytokine that plays a key role in the innate immune response to infection, developing tumors and other inflammatory stimuli (PubMed : 10708458, PubMed : 23872679). Signals via binding to high-affinity (IFNAR2) and low-affinity (IFNAR1) heterodimeric receptor, activating the canonical Jak-STAT signaling pathway resulting in transcriptional activation or repression of interferon-regulated genes that encode the effectors of the interferon response, such as antiviral proteins, regulators of cell proliferation and differentiation, and immunoregulatory proteins (By similarity). Signals mostly via binding to a IFNAR1-IFNAR2 heterodimeric receptor, but can also function with IFNAR1 alone and independently of Jak-STAT pathways (PubMed : 23872679). Elicits a wide variety of responses, including antiviral and antibacterial activities, and can regulate the development of B-cells, myelopoiesis and lipopolysaccharide (LPS)-inducible production of tumor necrosis factor (PubMed : 10708458, PubMed : 14597717). Plays a role in neuronal homeostasis by regulating dopamine turnover and protecting dopaminergic neurons : acts by promoting neuronal autophagy and alpha-synuclein clearance, thereby preventing dopaminergic neuron loss (PubMed : 26451483). IFNB1 is more potent than interferon-alpha (IFN-alpha) in inducing the apoptotic and antiproliferative pathways required for control of tumor cell growth (PubMed : 14597717).
See full target information Ifnb1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com