JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB95112

Native human Plasmin protein

Be the first to review this product! Submit a review

|

(0 Publication)

Native human Plasmin protein is a Human Full Length protein, expressed in Native, with >95%, suitable for FuncS.

View Alternative Names

Plasminogen, PLG

Key facts

Purity

>95% SDS-PAGE

Expression system

Native

Tags

Tag free

Applications

FuncS

applications

Biologically active

Yes

Biological activity

The human Lys plasmin is immobilised on agarose resin by coupling of primary amines.

Plasmin retains catalytic activity when coupled and may be used to efficiently activate single-chain tPA and uPA to the two-chain form.

Accession

P00747

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 2.38% HEPES, 0.58% Sodium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>It may be used to convert plasminogen from its native Glu form to the Lys form by removing the first 77 amino acids.</p>" } } }

Sequence info

[{"sequence":"MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Native","expressionSystem":"Native","accessionNumber":"P00747","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate long-term storage conditions
+4°C
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Plasmin a serine protease enzyme with a mass of approximately 79 kDa is an important player in the fibrinolytic system. Commonly referred to by alternate names like profibrinolysin or fibrinolysin it is mainly expressed in the liver and circulates in the blood as an inactive zymogen called plasminogen. Plasminogen is activated to plasmin through the action of activators such as tissue plasminogen activator (tPA) and urokinase (uPA). The activation to plasmin involves a cleavage at specific peptide bonds which exposes the active site that allows it to function as a protease.
Biological function summary

The enzyme plasmin degrades fibrin in blood clots a critical function in the process of clot resolution. It belongs to the family of serine proteases and does not form part of a larger protein complex. The activity of plasmin is modulated by inhibitors like alpha-2-antiplasmin which bind to plasmin and prevent excessive degradation of fibrin. Bovine plasmin shares similar functions and serves as a model for studying human plasmin activity. Researchers often measure plasmin activity through specific assays to understand changes in fibrinolytic activity within the body.

Pathways

Plasmin plays an integral role in the fibrinolytic pathway and is also involved in tissue remodeling and wound healing. The fibrinolytic pathway centers on the balance of plasminogen activation and inhibition which directly influences thrombolysis. Proteins such as tPA and uPA facilitate the conversion of plasminogen to plasmin and are tightly regulated to ensure proper physiological function. In the context of wound healing plasmin helps activate matrix metalloproteases leading to extracellular matrix breakdown and cell migration.

The regulation of plasmin is closely associated with pathological conditions such as thrombosis and liver disease. An overactive plasmin system can result in conditions like excessive bleeding or hemorrhage while inadequate plasmin activity may lead to thrombosis due to impaired clot breakdown. The interaction between plasmin and plasmin inhibitors like alpha-2-antiplasmin is critical in diseases such as liver cirrhosis where imbalances in fibrinolysis can have significant clinical outcomes. Understanding these interactions helps in developing therapeutic strategies to modulate plasmin activity in various disorders.

Specifications

Form

Liquid

General info

Function

Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1, C4 and C5 (PubMed : 6447255). Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells.. Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo.. (Microbial infection) ENO/enoloase from parasite P.falciparum (strain NF54) interacts with PLG present in the mosquito blood meal to promote the invasion of the mosquito midgut by the parasite ookinete (PubMed : 21949403). The catalytic active form, plasmin, is essential for the invasion of the mosquito midgut (PubMed : 21949403).. (Microbial infection) Binds to OspC on the surface of B.burgdorferi cells, possibly conferring an extracellular protease activity on the bacteria that allows it to traverse host tissue.. (Microbial infection) Interacts with dengue virus type 2 particles (PubMed : 31726374). Enhances dengue virus type 2 infection in Aedes aegypti mosquito midgut by increasing midgut internalization, resulting in higher infection rates and viral dissemination in mosquitoes (PubMed : 31726374).

Sequence similarities

Belongs to the peptidase S1 family. Plasminogen subfamily.

Post-translational modifications

N-linked glycan contains N-acetyllactosamine and sialic acid. O-linked glycans consist of Gal-GalNAc disaccharide modified with up to 2 sialic acid residues (microheterogeneity).. In the presence of the inhibitor, the activation involves only cleavage after Arg-580, yielding two chains held together by two disulfide bonds. In the absence of the inhibitor, the activation involves additionally the removal of the activation peptide.. (Microbial infection) The Y.pestis Pla protein cleaves between Arg-580 and Val-581, generating plasmin which facilitates bacterial migration and infection (PubMed:22645135).

Product protocols

Target data

Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1, C4 and C5 (PubMed : 6447255). Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells.. Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo.. (Microbial infection) ENO/enoloase from parasite P.falciparum (strain NF54) interacts with PLG present in the mosquito blood meal to promote the invasion of the mosquito midgut by the parasite ookinete (PubMed : 21949403). The catalytic active form, plasmin, is essential for the invasion of the mosquito midgut (PubMed : 21949403).. (Microbial infection) Binds to OspC on the surface of B.burgdorferi cells, possibly conferring an extracellular protease activity on the bacteria that allows it to traverse host tissue.. (Microbial infection) Interacts with dengue virus type 2 particles (PubMed : 31726374). Enhances dengue virus type 2 infection in Aedes aegypti mosquito midgut by increasing midgut internalization, resulting in higher infection rates and viral dissemination in mosquitoes (PubMed : 31726374).
See full target information PLG

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com