JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB135018

Recombinant ADA protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant ADA protein (His tag N-Terminus) is a Human Full Length protein, in the 2 to 331 aa range, expressed in Escherichia coli, with >60%, suitable for SDS-PAGE.

View Alternative Names

ADA1, ADA, Adenosine deaminase, Adenosine aminohydrolase

1 Images
SDS-PAGE - Recombinant ADA protein (His tag N-Terminus) (AB135018)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant ADA protein (His tag N-Terminus) (AB135018)

10% SDS-PAGE analysis of ab135018 (6 μg) stained with Coomassie Blue.

Key facts

Purity

>60% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P00813

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Preservative: 1.36% Imidazole Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"IDTSIPLVDLHRHLDGNVRVNTIWELGHQHGIALPADSLETLAPFVQIQGKETSLVAFLKKLDWMVAVLADLDAVKRVAYENVADAALSGLDYAELRFSPYYMAMNHKLPIEGVVEAVVDGVKAGLKDYNVKINLIGIMSRSFGQAACTQELEGLLAHKQHLVAMDLAGDELGFPGELFNDHFKRVRDAGLAITAHAGEAAGSQSMWQAIQELGATRIGHGVNAIHDPKLMEYLAKHRIGIESCPTSNLHTSTVVSYAEHPFRTFMDAGVLISLNTDDPGVSAIDIKHEYRIAKSELKLTDAELARVQRNGVEMAFLSDSERKALYAAKI","proteinLength":"Full Length","predictedMolecularWeight":"37 kDa","actualMolecularWeight":null,"aminoAcidEnd":331,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P00813","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Adenosine deaminase (ADA) sometimes known as deaminase is an enzyme that plays a critical mechanical role in cellular metabolism. This enzyme catalyzes the deamination of adenosine converting it into inosine. ADA is a 41 kDa protein primarily expressed in most tissues including the thymus and spleen. Various ADA assays and ADA protocols exist to study its functionality and quantification often using ADA ELISA kits to measure ADA activity in biological samples. In cell lines such as HeLa ADA expression is also present and significant for studying its regulation and function.
Biological function summary

Adenosine deaminase activity influences purine metabolism playing an important role in the breakdown of adenosine. It is not part of a complex but interacts closely with other components of the purine salvage pathway to maintain nucleotide balance. This enzyme is important for the proper function of immune cells as it prevents toxic accumulations of adenosine which can be detrimental to lymphocyte proliferation and function. ADA's activity ensures the proper management of nucleotides within cells sustaining cellular health and functionality.

Pathways

Adenosine deaminase plays significant roles in the immune and purine catabolism pathways. Within these pathways ADA is closely related to proteins such as purine nucleoside phosphorylase (PNP) which together orchestrate the steps necessary for adenine and guanine nucleotide turnover. These proteins facilitate the conversion processes needed for cellular nucleic acid synthesis and energy regulation. By managing adenosine levels ADA's function ensures the smooth operation of cellular signaling and metabolic balance.

Adenosine deaminase deficiency is linked to severe combined immunodeficiency (SCID) and can also be associated with pulmonary disorders like asthma. A lack of ADA activity leads to the accumulation of toxic metabolites impairing immune function and contributing to the pathogenesis of SCID. In some patients with pulmonary disorders altered ADA activity impacts the inflammatory response. ADA's mechanistic interactions with other proteins such as PNP highlight its importance in maintaining immune competence and metabolic homeostasis emphasizing the enzyme's role in these clinical conditions.

Specifications

Form

Liquid

General info

Function

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine (PubMed : 16670267, PubMed : 23193172, PubMed : 26166670, PubMed : 8452534, PubMed : 9361033). Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. Acts as a positive regulator of T-cell coactivation, by binding DPP4 (PubMed : 20959412). Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion (PubMed : 11772392). Enhances dendritic cell immunogenicity by affecting dendritic cell costimulatory molecule expression and cytokines and chemokines secretion (By similarity). Enhances CD4+ T-cell differentiation and proliferation (PubMed : 20959412). Acts as a positive modulator of adenosine receptors ADORA1 and ADORA2A, by enhancing their ligand affinity via conformational change (PubMed : 23193172). Stimulates plasminogen activation (PubMed : 15016824). Plays a role in male fertility (PubMed : 21919946, PubMed : 26166670). Plays a protective role in early postimplantation embryonic development (By similarity). Also responsible for the deamination of cordycepin (3'-deoxyadenosine), a fungal natural product that shows antitumor, antibacterial, antifungal, antivirus, and immune regulation properties (PubMed : 26038697).

Sequence similarities

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

Subcellular localisation

Lysosome

Product protocols

Target data

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine (PubMed : 16670267, PubMed : 23193172, PubMed : 26166670, PubMed : 8452534, PubMed : 9361033). Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. Acts as a positive regulator of T-cell coactivation, by binding DPP4 (PubMed : 20959412). Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion (PubMed : 11772392). Enhances dendritic cell immunogenicity by affecting dendritic cell costimulatory molecule expression and cytokines and chemokines secretion (By similarity). Enhances CD4+ T-cell differentiation and proliferation (PubMed : 20959412). Acts as a positive modulator of adenosine receptors ADORA1 and ADORA2A, by enhancing their ligand affinity via conformational change (PubMed : 23193172). Stimulates plasminogen activation (PubMed : 15016824). Plays a role in male fertility (PubMed : 21919946, PubMed : 26166670). Plays a protective role in early postimplantation embryonic development (By similarity). Also responsible for the deamination of cordycepin (3'-deoxyadenosine), a fungal natural product that shows antitumor, antibacterial, antifungal, antivirus, and immune regulation properties (PubMed : 26038697).
See full target information ADA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com