JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB63816

Recombinant E. coli LexA protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant E. coli LexA protein is a Escherichia coli K-12 Full Length protein, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

exrA, spr, tsl, umuA, b4043, JW4003, lexA, LexA repressor, Lex A, LexA repressor

2 Images
SDS-PAGE - Recombinant E. coli LexA protein (AB63816)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant E. coli LexA protein (AB63816)

SDS-PAGE analysis of Recombinant E. coli LexA protein (ab63816).

SDS-PAGE - Recombinant E. coli LexA protein (AB63816)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant E. coli LexA protein (AB63816)

SDS Page analysis of ab63816

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P0A7C2

Animal free

No

Carrier free

No

Species

Escherichia coli K-12

Storage buffer

pH: 6 - 8.5 Constituents: 50% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.158% Tris HCl, 0.0584% EDTA, 0.039% 2-Mercaptoethanol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein can be used in: 1) Studies on the mechanism of E. coli SOS response. 2) Used as an antigen for positive control in Western blotting to confirm that the Bait construct is expressed stably in the nucleus as protein of the expected size in the yeast two-hybrid method using the lexA gene.

Sequence info

[{"sequence":"MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P0A7C2","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LexA also known as the LexA protein is a bacterial transcriptional repressor well-studied in Escherichia coli. The LexA protein has a molecular mass of approximately 22 kilodaltons. It is primarily expressed in the cytoplasm of bacterial cells where it plays an important role in controlling the expression of several genes. The LexA protein acts by binding to specific DNA sequences known as 'SOS boxes' found in the promoter regions of genes involved in DNA repair and cell division thereby repressing their transcription under normal conditions.
Biological function summary

LexA plays a critical function in the bacterial SOS response to DNA damage. When DNA damage occurs the LexA protein is part of the SOS regulon a regulatory network that includes genes involved in DNA repair cell cycle arrest and mutagenesis. Upon sensing DNA damage LexA undergoes autocleavage facilitated by the RecA protein leading to derepression of the SOS genes. The processes controlled by LexA are essential for the survival of bacteria under stressful conditions ensuring repair and recovery from DNA damage.

Pathways

LexA is central in the SOS response pathway a well-characterized system activated in response to DNA damage in bacteria. This pathway involves interaction with RecA which promotes LexA autocleavage when bound to single-stranded DNA. The regulatory orchestration between LexA and RecA is important for mediating the induction of DNA repair enzymes and cell division inhibitors ensuring bacterial adaptation and survival. Another interconnected pathway is the DNA repair mechanism which is important for genomic integrity maintenance in bacteria.

The LexA protein indirectly affects antibiotic resistance through alteration in the SOS response pathway. Mutations affecting LexA function can lead to increased mutation rates and the propagation of antibiotic resistance genes. Moreover LexA has implications in bacterial pathogenicity where inducement of the SOS response can enhance virulence factors in some bacterial strains. The understanding of LexA functions could provide novel insights for developing strategies to combat bacterial resistance as the regulation of the SOS pathway and related proteins like RecA might be targeted to curb the adaptability of pathogenic bacteria.

Specifications

Form

Liquid

Additional notes

highly purified by several steps of chromatography

General info

Function

Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5'-CTGTATATATATACAG-3'. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair. Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment (PubMed : 20005847). The SOS response controls an apoptotic-like death (ALD) induced (in the absence of the mazE-mazF toxin-antitoxin module) in response to DNA damaging agents that is mediated by RecA and LexA (PubMed : 22412352). Genetic interactions among priB, dam, lexA, nagC, polA, rdgB, rdgB, rep and uup link the PriA-PriB replication restart pathway to DNA double-strand break repair (PubMed : 36326440).

Sequence similarities

Belongs to the peptidase S24 family.

Product protocols

Target data

Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Binds to the 16 bp palindromic sequence 5'-CTGTATATATATACAG-3'. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair. Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment (PubMed : 20005847). The SOS response controls an apoptotic-like death (ALD) induced (in the absence of the mazE-mazF toxin-antitoxin module) in response to DNA damaging agents that is mediated by RecA and LexA (PubMed : 22412352). Genetic interactions among priB, dam, lexA, nagC, polA, rdgB, rdgB, rep and uup link the PriA-PriB replication restart pathway to DNA double-strand break repair (PubMed : 36326440).
See full target information lexA

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

PloS one 12:e0178303 PubMed28542496

2017

Zinc blocks SOS-induced antibiotic resistance via inhibition of RecA in Escherichia coli.

Applications

Unspecified application

Species

Unspecified reactive species

Bryan E Bunnell,Jillian F Escobar,Kirsten L Bair,Mark D Sutton,John K Crane
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com