JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB63828

Recombinant E. coli RuvC protein (Active)

Be the first to review this product! Submit a review

|

(4 Publications)

Recombinant E. coli RuvC protein (Active) is a Escherichia coli K-12 Full Length protein, expressed in Escherichia coli, with >90%, suitable for ELISA, WB, FuncS, SDS-PAGE.

View Alternative Names

b1863, JW1852, ruvC, Crossover junction endodeoxyribonuclease RuvC, Holliday junction endonuclease RuvC, Holliday junction nuclease RuvC, Holliday junction resolvase RuvC

1 Images
SDS-PAGE - Recombinant E. coli RuvC protein (Active) (AB63828)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant E. coli RuvC protein (Active) (AB63828)

SDS-PAGE analysis of Recombinant E. coli RuvC protein (ab63828).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS, ELISA, WB

applications

Biologically active

Yes

Biological activity

Active

Accession

P0A814

Animal free

No

Carrier free

No

Species

Escherichia coli K-12

Storage buffer

pH: 6 - 8.5 Constituents: 50% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.158% Tris HCl, 0.0584% EDTA, 0.039% 2-Mercaptoethanol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Functional studies in vitro. RuvC cleaves recombination intermediate at Holliday Junction.</p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"0.2 µg/mL", "notes":"<p></p>" } } }

Product details

ab63828 can be used for: 1) Studies on the homologous recombination mechanism. 2) To use as an endonuclease which functions specifically to the Holliday structure.

Sequence info

[{"sequence":"MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P0A814","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Stable for 12 months at -20°C
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RuvC also known as Holliday junction resolvase functions as an endonuclease that resolves Holliday junctions during DNA recombination and repair. It cleaves these four-way junctions to produce linear DNA duplexes promoting genetic diversity and genome stability. RuvC is a small protein with a mass of around 19 kDa. It is generally expressed in prokaryotes such as Escherichia coli and can localize to regions of DNA that undergo active recombination processes.
Biological function summary

RuvC ensures proper segregation of homologous chromosomes by processing DNA during cell division. It operates as a part of the RuvABC complex which consists of the RuvA and RuvB proteins in addition to RuvC. RuvA binds to the Holliday junctions and recruits RuvB forming a branch migration motor. RuvC then cleaves the junctions resolving them. This activity plays a major role in maintaining genetic stability by enabling the accurate exchange of genetic material.

Pathways

RuvC contributes significantly to homologous recombination and DNA repair mechanisms. It participates within the homologous recombination repair pathway intertwining with proteins such as RecA which facilitates the alignment of homologous DNA sequences and RecBCD a helicase/nuclease involved in processing DNA double-strand breaks. RuvC acts after RecA-mediated strand invasion to resolve recombination intermediates.

Impaired function of proteins homologous to RuvC in eukaryotes can relate to genomic instability and cancer. For example the absence or dysfunction of similar pathways in humans can lead to hereditary nonpolyposis colorectal cancer (HNPCC) where proteins like MLH1 part of the homologous recombination repair machinery are involved. These linkages highlight the critical nature of Holliday junction resolution in preventing unrepaired DNA damage accumulation reducing the risk of oncogenic transformations.

Specifications

Form

Liquid

General info

Function

The RuvA-RuvB-RuvC complex processes Holliday junctions during genetic recombination and DNA repair (PubMed : 6374379). Endonuclease that resolves Holliday junction (HJ) intermediates. Cleaves cruciform DNA by making single-stranded nicks across the junction at symmetrical positions within the homologous arms, leaving a 5'-phosphate and a 3'-hydroxyl group; requires a central core of homology in the junction (PubMed : 10471285, PubMed : 1661673, PubMed : 1758493, PubMed : 1829835, PubMed : 36000732, PubMed : 8001122, PubMed : 8106500, PubMed : 8195150, PubMed : 9000618, PubMed : 9135161, PubMed : 9160752). The consensus cleavage sequence is 5'-(A/T)TT(C>G/A)-3'. Cleavage occurs on the 3'-side of the TT dinucleotide at the point of strand exchange, although there is some flexibility in the position cleaved (PubMed : 10471285, PubMed : 8001122, PubMed : 8195150, PubMed : 9135161). The cleavage reactions can be uncoupled; incision requires the presence of two consensus cleavage sequences, although they do not have to be identical (PubMed : 9135161). The presence of a 5'-phosphate in a half-cut site accelerates cleavage of the second site, ensuring the second cleavage occurs within the lifetime of a single RuvC-HJ complex (PubMed : 19399178). Binds to cruciform DNA in a sequence non-specific manner (PubMed : 10471285, PubMed : 8106500, PubMed : 8195150).. An in vitro resolvase system that forms and processes HJ has been reconstituted with DNA substrates, RuvA, RuvB and RuvC. RuvA-RuvB increases the rate of strand exchange (branch migration), dissociates the RecA filament and allows RuvC to cleave in both orientations at the cruciform junction (PubMed : 10421637, PubMed : 9160752). HJ-RuvA-RuvB-RuvC complexes resolve Holliday junctions and also undergo branch migration, providing evidence for a coupled branch migration/HJ resolution reaction (PubMed : 10421637).

Sequence similarities

Belongs to the RuvC family.

Product protocols

Target data

The RuvA-RuvB-RuvC complex processes Holliday junctions during genetic recombination and DNA repair (PubMed : 6374379). Endonuclease that resolves Holliday junction (HJ) intermediates. Cleaves cruciform DNA by making single-stranded nicks across the junction at symmetrical positions within the homologous arms, leaving a 5'-phosphate and a 3'-hydroxyl group; requires a central core of homology in the junction (PubMed : 10471285, PubMed : 1661673, PubMed : 1758493, PubMed : 1829835, PubMed : 36000732, PubMed : 8001122, PubMed : 8106500, PubMed : 8195150, PubMed : 9000618, PubMed : 9135161, PubMed : 9160752). The consensus cleavage sequence is 5'-(A/T)TT(C>G/A)-3'. Cleavage occurs on the 3'-side of the TT dinucleotide at the point of strand exchange, although there is some flexibility in the position cleaved (PubMed : 10471285, PubMed : 8001122, PubMed : 8195150, PubMed : 9135161). The cleavage reactions can be uncoupled; incision requires the presence of two consensus cleavage sequences, although they do not have to be identical (PubMed : 9135161). The presence of a 5'-phosphate in a half-cut site accelerates cleavage of the second site, ensuring the second cleavage occurs within the lifetime of a single RuvC-HJ complex (PubMed : 19399178). Binds to cruciform DNA in a sequence non-specific manner (PubMed : 10471285, PubMed : 8106500, PubMed : 8195150).. An in vitro resolvase system that forms and processes HJ has been reconstituted with DNA substrates, RuvA, RuvB and RuvC. RuvA-RuvB increases the rate of strand exchange (branch migration), dissociates the RecA filament and allows RuvC to cleave in both orientations at the cruciform junction (PubMed : 10421637, PubMed : 9160752). HJ-RuvA-RuvB-RuvC complexes resolve Holliday junctions and also undergo branch migration, providing evidence for a coupled branch migration/HJ resolution reaction (PubMed : 10421637).
See full target information ruvC

Publications (4)

Recent publications for all applications. Explore the full list and refine your search

Nucleic acids research 51:9144-9165 PubMed37526271

2023

FANCD2 and RAD51 recombinase directly inhibit DNA2 nuclease at stalled replication forks and FANCD2 acts as a novel RAD51 mediator in strand exchange to promote genome stability.

Applications

Unspecified application

Species

Unspecified reactive species

Wenpeng Liu,Piotr Polaczek,Ivan Roubal,Yuan Meng,Won-Chae Choe,Marie-Christine Caron,Carl A Sedgeman,Yu Xi,Changwei Liu,Qiong Wu,Li Zheng,Jean-Yves Masson,Binghui Shen,Judith L Campbell

Nucleic acids research 49:2803-2815 PubMed33619520

2021

Single bacterial resolvases first exploit, then constrain intrinsic dynamics of the Holliday junction to direct recombination.

Applications

Unspecified application

Species

Unspecified reactive species

Sujay Ray,Nibedita Pal,Nils G Walter

Molecular cell 69:9-23.e6 PubMed29290614

2018

Topoisomerase 3α Is Required for Decatenation and Segregation of Human mtDNA.

Applications

Unspecified application

Species

Unspecified reactive species

Thomas J Nicholls,Cristina A Nadalutti,Elisa Motori,Ewen W Sommerville,Gráinne S Gorman,Swaraj Basu,Emily Hoberg,Doug M Turnbull,Patrick F Chinnery,Nils-Göran Larsson,Erik Larsson,Maria Falkenberg,Robert W Taylor,Jack D Griffith,Claes M Gustafsson

Nature communications 5:5652 PubMed25466415

2014

Mus81-Mms4 and Yen1 resolve a novel anaphase bridge formed by noncanonical Holliday junctions.

Applications

Unspecified application

Species

Unspecified reactive species

Jonay García-Luis,Félix Machín
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com