JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB240835

Recombinant EBV Latent Membrane Protein 1 (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant EBV Latent Membrane Protein 1 (His tag) is a Epstein-Barr virus Fragment protein, in the 185 to 366 aa range, expressed in Yeast, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

BNLF1, LMP1, Latent membrane protein 1, LMP-1, Protein p63, BNLF1, EBV, Epstein Barr virus, HHV4, Human Herpesvirus 4, Latent membrane protein 1

3 Images
Mass Spectrometry - Recombinant EBV Latent Membrane Protein 1 (His tag) (AB240835)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant EBV Latent Membrane Protein 1 (His tag) (AB240835)

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab240835 could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) EBV Latent Membrane Protein 1.

Mass Spectrometry - Recombinant EBV Latent Membrane Protein 1 (His tag) (AB240835)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant EBV Latent Membrane Protein 1 (His tag) (AB240835)

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab240835 could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) EBV Latent Membrane Protein 1.

SDS-PAGE - Recombinant EBV Latent Membrane Protein 1 (His tag) (AB240835)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant EBV Latent Membrane Protein 1 (His tag) (AB240835)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab240835.

Key facts

Purity

>90% SDS-PAGE

Expression system

Yeast

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P0C741

Animal free

No

Carrier free

No

Species

Epstein-Barr virus

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD","proteinLength":"Fragment","predictedMolecularWeight":"20.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":366,"aminoAcidStart":185,"nature":"Recombinant","expressionSystem":"Yeast","accessionNumber":"P0C741","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

EBV Latent Membrane Protein 1 also known as LMP1 is an important oncoprotein of Epstein-Barr virus (EBV). It acts mechanically to modulate cellular signaling pathways. LMP1 weighs approximately 63 kDa. This protein is highly expressed on the surface of lymphocytes and epithelial cells during latent EBV infection. LMP1 comprises several functional domains including Cytoplasmic Tail 1 (CS1) Cytoplasmic Tail 2 (CS2) and Cytoplasmic Tail 3 (CS3). Researchers often study its presence through methods like LMP1 immunohistochemistry (IHC)
Biological function summary

The protein plays a role in cellular transformation and proliferation acting as a mimic of CD40 receptor signaling. Within cells LMP1 aggregates to form oligomeric complexes that actively recruit TRAF and TRADD adapter proteins. This aggregation leads to the activation of NF-κB signaling and the MAPK pathways contributing to increased cell survival and proliferation. LMP1 functions as a major factor in sustaining EBV latency in infected cells and is essential for the virus's oncogenic potential.

Pathways

LMP1 is an integral component of the NF-κB and AP-1 signaling pathways. By engaging with the host cell machinery LMP1 recruits proteins such as IκB kinase complexes leading to the nuclear translocation of NF-κB transcription factors. This results in the transcription of genes related to cell growth and inflammation. LMP1 also interacts with p38 MAPK further enhancing pathways that contribute to EBV’s ability to foster an environment suitable for its persistence and propagation within the host.

LMP1 has strong associations with various malignancies especially nasopharyngeal carcinoma and Hodgkin's lymphoma. The protein’s role in disrupting normal cellular function relates it closely to the pathology of these cancers. It affects the expression of other proteins like c-Myc and Bcl-2 which are often found altered in malignancy. EBV antibodies particularly those targeting LMP1 are used to study the presence and progression of these diseases in infected individuals.

Specifications

Form

Liquid

General info

Function

Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses. Also inhibits host IFN-alpha-stimulated STAT2 nuclear translocation and interferon-stimulated response element transcriptional activity by interacting with and inhibiting host TYK2. Induces SUMO expression during viral latency thereby dysregulating the host sumoylation processes.

Sequence similarities

Belongs to the herpesviridae LMP-1 family.

Post-translational modifications

Ubiquitinated on the N-terminus.

Product protocols

Target data

Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses. Also inhibits host IFN-alpha-stimulated STAT2 nuclear translocation and interferon-stimulated response element transcriptional activity by interacting with and inhibiting host TYK2. Induces SUMO expression during viral latency thereby dysregulating the host sumoylation processes.
See full target information LMP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com