JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB134877

Recombinant EN-TEV Protease (mutated S219N) protein (Tagged-His Tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant EN-TEV Protease (mutated S219N) protein (Tagged-His Tag) is a Tobacco etch virus Full Length protein, in the 2037 to 2073 aa range, expressed in Escherichia coli, with >98%, suitable for SDS-PAGE, FuncS.

View Alternative Names

Genome polyprotein

1 Images
Functional Studies - Recombinant EN-TEV Protease (mutated S219N) protein (Tagged-His Tag) (AB134877)
  • FuncS

Unknown

Functional Studies - Recombinant EN-TEV Protease (mutated S219N) protein (Tagged-His Tag) (AB134877)

4-12% SDS-PAGE gel. M : Protein Marker
Lane 1 : N‐terminal tag HBxAg‐11R protein before TEV enzyme digestion.
Lane 2 : N‐terminal tag HBxAg‐11R protein digested using 1/50 dilution (1µg TEV/ 50µg target protein at 4°C for overnight reaction) in buffer 20 mM Tris‐HCl, pH 8.0, 100 mM KCl.

Key facts

Purity

>98% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Complete digestion of 50μg of T7 Tag-HBxAg protein using 1μg TEV enzyme (in 1/50 ratio) in either 3 hours at 37 °C or 12 hours at 4 °C.

The "standard" reaction buffer for TEV protease is 50 mM Tris-HCl (pH 8.0), 0.5 mM EDTA and 1mM DTT. The duration of the cleavage reaction is typically overnight, although lots of cleavage will happen in the first few hours and prolonged incubation times may not lead to proportional increases in cleavage. TEV protease is maximally active at 34 °C, but we recommend performing the digest at room temperature (20 °C) or 4 °C. TEV protease is only three-fold less active at 4 °C than at 20 °C.
Typically, a good rule of thumb for initial test of digestion is 1 μg TEV enzyme per 50 - 100μg target protein ratio. Perform a small-scale reaction first, if possible, to gauge the efficiency of processing.

Accession

P04517

Animal free

No

Carrier free

No

Species

Tobacco etch virus

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.015% EDTA

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"GHHHHHHHGESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNRRRRR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":2073,"aminoAcidStart":2037,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P04517","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

EN-TEV Protease also known simply as TEV protease is a specific proteolytic enzyme commonly utilized for its high specificity in cleaving peptide sequences. Its other popular name is Tobacco Etch Virus NIa protease and it has a molecular mass of approximately 27 kDa. TEV protease is expressed mainly in bacteria such as Escherichia coli when used in laboratory settings for protein preparation. Its ability to cleave at a specific sequence makes it invaluable in protein purification processes.
Biological function summary

The action of TEV protease involves recognizing and cleaving a specific sequence in fusion proteins allowing for the removal of affinity tags. Though not generally part of a complex its activity is often important for modifying proteins without interfering with their structure or function beyond the cleaved site. By providing a method to separate desired parts of proteins TEV protease enhances the study of protein functions and structures. It also assists in generating authentic recombinant proteins critical for various research applications.

Pathways

TEV protease's role mainly revolves around its function in post-translational modification processes rather than classical signaling pathways. It facilitates pathways where the removal of fusion tags is necessary for studying protein interactions and conformations. This function does not directly involve TEV protease in cellular metabolic pathways but its activity complements the activity of other proteases like Actev protease and protease assay protocol tools by providing a precise cleavage mechanism necessary for subsequent biochemical analysis and studies.

Although TEV protease does not directly relate to specific diseases it has a significant role in research involving proteins associated with various conditions. For instance in neurodegenerative studies researchers utilize TEV protease to isolate and study proteins potentially connected to disorders such as Alzheimer's disease. The protease substrate generated by its specific cleavage can be studied alongside proteins like tau which are linked to disease pathology. The ability to manipulate protein structures cleanly and efficiently with TEV protease underpins its utility in both clinical research and therapeutic development.

Specifications

Form

Liquid

Additional notes

ab134877 is sterile-filtered.

General info

Function

Helper component proteinase. Required for aphid transmission and also has proteolytic activity. Only cleaves a Gly-Gly dipeptide at its own C-terminus (PubMed : 2656254). Interacts with virions and aphid stylets (PubMed : 9880030). Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs (PubMed : 11414807). May have RNA-binding activity.. Cytoplasmic inclusion protein. Has helicase activity. It may be involved in replication.. 6 kDa protein 1. Indispensable for virus replication (By similarity). Reduces the abundance of host transcripts related to jasmonic acid biosynthesis therefore altering the host defenses (By similarity). In order to increase its own stability, decreases host protein degradation pathways (By similarity).. 6 kDa protein 2. Indispensable for virus replication.. Viral genome-linked protein. Mediates the cap-independent, EIF4E-dependent translation of viral genomic RNAs (Probable). Binds to the cap-binding site of host EIF4E and thus interferes with the host EIF4E-dependent mRNA export and translation (By similarity). VPg-RNA directly binds EIF4E and is a template for transcription (By similarity). Also forms trimeric complexes with EIF4E-EIF4G, which are templates for translation (By similarity).. Nuclear inclusion protein A. Has RNA-binding and proteolytic activities.. Nuclear inclusion protein B. An RNA-dependent RNA polymerase that plays an essential role in the virus replication.. Capsid protein. Involved in aphid transmission, cell-to-cell and systemis movement, encapsidation of the viral RNA and in the regulation of viral RNA amplification.

Sequence similarities

Belongs to the potyviridae genome polyprotein family.

Post-translational modifications

Viral genome-linked protein. VPg is uridylylated by the polymerase and is covalently attached to the 5'-end of the genomic RNA. This uridylylated form acts as a nucleotide-peptide primer for the polymerase (By similarity).. Genome polyprotein. Potyviral RNA is expressed as two polyproteins which undergo post-translational proteolytic processing. Genome polyprotein is processed by NIa-pro, P1 and HC-pro proteinases resulting in the production of at least ten individual proteins. P3N-PIPO polyprotein is cleaved by P1 and HC-pro proteinases resulting in the production of three individual proteins. The P1 proteinase and the HC-pro cleave only their respective C-termini autocatalytically. 6K1 is essential for proper proteolytic separation of P3 from CI (By similarity).

Product protocols

Target data

Helper component proteinase. Required for aphid transmission and also has proteolytic activity. Only cleaves a Gly-Gly dipeptide at its own C-terminus (PubMed : 2656254). Interacts with virions and aphid stylets (PubMed : 9880030). Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs (PubMed : 11414807). May have RNA-binding activity.. Cytoplasmic inclusion protein. Has helicase activity. It may be involved in replication.. 6 kDa protein 1. Indispensable for virus replication (By similarity). Reduces the abundance of host transcripts related to jasmonic acid biosynthesis therefore altering the host defenses (By similarity). In order to increase its own stability, decreases host protein degradation pathways (By similarity).. 6 kDa protein 2. Indispensable for virus replication.. Viral genome-linked protein. Mediates the cap-independent, EIF4E-dependent translation of viral genomic RNAs (Probable). Binds to the cap-binding site of host EIF4E and thus interferes with the host EIF4E-dependent mRNA export and translation (By similarity). VPg-RNA directly binds EIF4E and is a template for transcription (By similarity). Also forms trimeric complexes with EIF4E-EIF4G, which are templates for translation (By similarity).. Nuclear inclusion protein A. Has RNA-binding and proteolytic activities.. Nuclear inclusion protein B. An RNA-dependent RNA polymerase that plays an essential role in the virus replication.. Capsid protein. Involved in aphid transmission, cell-to-cell and systemis movement, encapsidation of the viral RNA and in the regulation of viral RNA amplification.
See full target information Genome polyprotein S219N

Additional targets

EN-TEV Protease

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com