JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB49036

Recombinant Hepatitis E Virus ORF2 antigen protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Hepatitis E Virus ORF2 antigen protein is a Hepatitis E virus (strain Burma) protein, in the 403 to 461 aa range, expressed in Escherichia coli, with >95%, suitable for ELISA, WB.

View Alternative Names

Pro-secreted protein ORF2, Protein ORF2, pORF2, ORF2, Pro-secreted protein ORF2, Protein ORF2, pORF2, ORF2, Pro-secreted protein ORF2, Protein ORF2, pORF2, ORF2, Pro-secreted protein ORF2, Protein ORF2, pORF2, ORF2, HEV ORF2, Hepatitis E Virus ORF2

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

WB, ELISA

applications

Biologically active

No

Accession

P29326

Animal free

No

Carrier free

No

Species

Hepatitis E virus (strain Burma)

Storage buffer

pH: 7.2 - 7.6 Constituents: 48% Urea, 0.316% Tris HCl, 0.078% 2-Mercaptoethanol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRVVIQDYDNQHEQDRPTPSPAPSRP","proteinLength":null,"predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":461,"aminoAcidStart":403,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q68985","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Hepatitis E Virus ORF2 antigen also known as the ORF2 protein is the major capsid protein of the hepatitis E virus (HEV). It plays an important role in forming the viral particle and is approximately 60 kDa in mass. ORF2 protein is expressed primarily in infected hepatocytes but viral shedding studies detect it in bodily fluids like feces and blood serum during HEV infection. Viral structural proteins like the ORF2 protein are essential for understanding HEV assembly and transmission.
Biological function summary

The ORF2 protein facilitates essential processes in the HEV life cycle. It encompasses virus attachment entry and eventually the encapsidation of the viral RNA. This protein is involved in forming a protective layer around the viral genetic material playing a critical role in host immune evasion. The ability of ORF2 to form virus-like particles makes it a significant component in vaccine development and serological assays intended for hepatitis E diagnosis.

Pathways

ORF2 protein participates actively in pathways related to HEV capsid assembly and virus-host interaction. Its functions intersect with the immune response evasion mechanisms where it interacts with host cellular proteins to help the virus elude immune detection. The ORF2 is often studied alongside other HEV proteins such as ORF3 which aids in viral particle release reflecting their collaborative roles in ensuring efficient viral propagation and survival within the host.

The Hepatitis E Virus ORF2 antigen is directly linked to hepatitis E often associated with acute liver inflammation. The interaction of ORF2 protein with host immune components is important in the disease's progression leading to symptoms like jaundice and liver dysfunction. Research into ORF2 also examines its relationship with other hepatotropic viruses assessing the cross-reactivity or co-infection potential especially in hepatitis B and C. Understanding these interactions enhances strategies for therapeutic developments and vaccine production against hepatitis E and related viral hepatitis infections.

Specifications

Form

Liquid

General info

Function

Isoform Secreted protein ORF2. Plays a role in the inhibition of host antibody-mediated neutralization without blocking viral cell entry.. Isoform Capsid protein. Forms an icosahedral capsid with a T=1 symmetry and a 34 nm diameter. The capsid is composed of 60 copies linked to each other. Binds to the 5' end of the genomic RNA to mediate genome encapsidation (PubMed : 14671114, PubMed : 15557331). Binds to heparin surface proteoglycans (HSPGs) to mediate viral entry (By similarity). Additionally, the interactions with host ASGR1 and ASGR2 facilitate viral infection of hepatocytes (By similarity). Inhibits IFN production by blocking host TBK1-induced IRF3 phosphorylation (By similarity). The nuclear form probably modulates host gene expression (By similarity).

Sequence similarities

Belongs to the hepevirus capsid protein family.

Post-translational modifications

Pro-secreted protein ORF2. Cleaved by host protease in the N-terminus.. Isoform Secreted protein ORF2. N-glycosylated.. Isoform Capsid protein. Not N-glycosylated. The C-terminus of the capsid protein ORF2 is truncated in non-enveloped virions shedded in feces, probably due to host proteases.

Product protocols

Target data

Isoform Secreted protein ORF2. Plays a role in the inhibition of host antibody-mediated neutralization without blocking viral cell entry.. Isoform Capsid protein. Forms an icosahedral capsid with a T=1 symmetry and a 34 nm diameter. The capsid is composed of 60 copies linked to each other. Binds to the 5' end of the genomic RNA to mediate genome encapsidation (PubMed : 14671114, PubMed : 15557331). Binds to heparin surface proteoglycans (HSPGs) to mediate viral entry (By similarity). Additionally, the interactions with host ASGR1 and ASGR2 facilitate viral infection of hepatocytes (By similarity). Inhibits IFN production by blocking host TBK1-induced IRF3 phosphorylation (By similarity). The nuclear form probably modulates host gene expression (By similarity).
See full target information ORF2

Additional targets

,,,ORF2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com