JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB307486

Recombinant HIV surface protein gp120 (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant HIV surface protein gp120 (Active) is a Human immunodeficiency virus type 1 (BH8 ISOLATE) Fragment protein, in the 33 to 506 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for HPLC, SDS-PAGE, FuncS.

View Alternative Names

Envelope glycoprotein gp160, Env polyprotein, env

3 Images
Biological Activity - Recombinant HIV surface protein gp120 (Active) (AB307486)
  • Biological Activity

Supplier Data

Biological Activity - Recombinant HIV surface protein gp120 (Active) (AB307486)

Loaded Human CD4, Human Fc Tag on Protein A Biosensor can bind HIV surface protein gp120, His tag with an affinity constant of 271 uM as determined in BLI assay (GatorBio Prime)

HPLC - Recombinant HIV surface protein gp120 (Active) (AB307486)
  • HPLC

Supplier Data

HPLC - Recombinant HIV surface protein gp120 (Active) (AB307486)

HPLC analysis of ab307486

SDS-PAGE - Recombinant HIV surface protein gp120 (Active) (AB307486)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant HIV surface protein gp120 (Active) (AB307486)

SDS-PAGE analysis of ab307486

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

HPLC, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Loaded Human CD4, Human Fc Tag on Protein A Biosensor can bind HIV surface protein gp120, His tag with an affinity constant of 271 uM as determined in BLI assay (GatorBio Prime)

Accession

P04582

Animal free

Yes

Carrier free

No

Species

Human immunodeficiency virus type 1 (BH8 ISOLATE)

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KLWVTVYFGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSKRGKVQKEYAFFYKLDIIPIDNDTTSYTLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLDTSVEINCTRPNNNTRKKIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNATLKQIDSKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWSTKGSNNTEGSDTITLPCRIKQIINMWQEVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR","proteinLength":"Fragment","predictedMolecularWeight":"54.51 kDa","actualMolecularWeight":"54.51 kDa","aminoAcidEnd":506,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P04582","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The HIV1 gp41 protein also known as the gp41 HIV protein is a glycoprotein that plays a mechanical role in the virus's capacity to fuse with host cells. This protein is 41 kDa in mass and is part of the viral envelope expressed on the surface of the HIV virus. Gp41 works closely with the gp120 protein to facilitate the fusion process a critical step in viral entry into lymphocytes. The 1d4 is sometimes used to refer to certain related domains or epitopes within the gp41 structure.
Biological function summary

During the infection process gp41 acts by mediating membrane fusion between the HIV viral envelope and the host cell membrane. It forms part of the Env complex consisting of gp120 and gp41 proteins which together create the functional envelope glycoprotein spike on the virus. This spike binds to receptors on the host cell such as the CD4 molecule which initiates changes that reveal the gp41 protein allowing it to insert into the host cell membrane and pull the viral and cellular membranes together.

Pathways

Involving HIV1 gp41 and its associated proteins the gp41 protein is a critical player in the viral entry pathway. After gp120 binds to the CD4 receptor and coreceptors such as CCR5 or CXCR4 on the host cell this conformational change exposes gp41 to carry out the fusion of viral and host membranes. The Env complex through gp41 and gp120 proteins coordinates this entry process integrating the viral genetic material with the host genome which is important for HIV propagation.

Involving the HIV1 gp41 protein it is directly related to the progression of HIV/AIDS. Gp41's function in viral entry makes it a target for antiviral drugs and vaccine development as inhibiting gp41 could block the virus from invading host cells. The interplay with gp120 and the interaction with host proteins like CD4 highlight the potential for gp41 as a therapeutic target in efforts to prevent or treat HIV infection.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >= 95%

General info

Function

Envelope glycoprotein gp160. Oligomerizes in the host endoplasmic reticulum into predominantly trimers. In a second time, gp160 transits in the host Golgi, where glycosylation is completed. The precursor is then proteolytically cleaved in the trans-Golgi and thereby activated by cellular furin or furin-like proteases to produce gp120 and gp41.. Surface protein gp120. Attaches the virus to the host lymphoid cell by binding to the primary receptor CD4. This interaction induces a structural rearrangement creating a high affinity binding site for a chemokine coreceptor like CXCR4 and/or CCR5. Acts as a ligand for CD209/DC-SIGN and CLEC4M/DC-SIGNR, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses. These interactions allow capture of viral particles at mucosal surfaces by these cells and subsequent transmission to permissive cells. HIV subverts the migration properties of dendritic cells to gain access to CD4+ T-cells in lymph nodes. Virus transmission to permissive T-cells occurs either in trans (without DCs infection, through viral capture and transmission), or in cis (following DCs productive infection, through the usual CD4-gp120 interaction), thereby inducing a robust infection. In trans infection, bound virions remain infectious over days and it is proposed that they are not degraded, but protected in non-lysosomal acidic organelles within the DCs close to the cell membrane thus contributing to the viral infectious potential during DCs' migration from the periphery to the lymphoid tissues. On arrival at lymphoid tissues, intact virions recycle back to DCs' cell surface allowing virus transmission to CD4+ T-cells.. Transmembrane protein gp41. Acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states : pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of viral and target intracellular membranes, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Complete fusion occurs in host cell endosomes and is dynamin-dependent, however some lipid transfer might occur at the plasma membrane. The virus undergoes clathrin-dependent internalization long before endosomal fusion, thus minimizing the surface exposure of conserved viral epitopes during fusion and reducing the efficacy of inhibitors targeting these epitopes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm.

Sequence similarities

Belongs to the HIV-1 env protein family.

Post-translational modifications

Highly glycosylated by host. The high number of glycan on the protein is reffered to as 'glycan shield' because it contributes to hide protein sequence from adaptive immune system.. Palmitoylation of the transmembrane protein and of Env polyprotein (prior to its proteolytic cleavage) is essential for their association with host cell membrane lipid rafts. Palmitoylation is therefore required for envelope trafficking to classical lipid rafts, but not for viral replication.. Specific enzymatic cleavages in vivo yield mature proteins. Envelope glycoproteins are synthesized as an inactive precursor that is heavily N-glycosylated and processed likely by host cell furin in the Golgi to yield the mature SU and TM proteins. The cleavage site between SU and TM requires the minimal sequence [KR]-X-[KR]-R. About 2 of the 9 disulfide bonds of gp41 are reduced by P4HB/PDI, following binding to CD4 receptor.

Subcellular localisation

Host endosome membrane

Product protocols

Target data

Envelope glycoprotein gp160. Oligomerizes in the host endoplasmic reticulum into predominantly trimers. In a second time, gp160 transits in the host Golgi, where glycosylation is completed. The precursor is then proteolytically cleaved in the trans-Golgi and thereby activated by cellular furin or furin-like proteases to produce gp120 and gp41.. Surface protein gp120. Attaches the virus to the host lymphoid cell by binding to the primary receptor CD4. This interaction induces a structural rearrangement creating a high affinity binding site for a chemokine coreceptor like CXCR4 and/or CCR5. Acts as a ligand for CD209/DC-SIGN and CLEC4M/DC-SIGNR, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses. These interactions allow capture of viral particles at mucosal surfaces by these cells and subsequent transmission to permissive cells. HIV subverts the migration properties of dendritic cells to gain access to CD4+ T-cells in lymph nodes. Virus transmission to permissive T-cells occurs either in trans (without DCs infection, through viral capture and transmission), or in cis (following DCs productive infection, through the usual CD4-gp120 interaction), thereby inducing a robust infection. In trans infection, bound virions remain infectious over days and it is proposed that they are not degraded, but protected in non-lysosomal acidic organelles within the DCs close to the cell membrane thus contributing to the viral infectious potential during DCs' migration from the periphery to the lymphoid tissues. On arrival at lymphoid tissues, intact virions recycle back to DCs' cell surface allowing virus transmission to CD4+ T-cells.. Transmembrane protein gp41. Acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states : pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of viral and target intracellular membranes, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Complete fusion occurs in host cell endosomes and is dynamin-dependent, however some lipid transfer might occur at the plasma membrane. The virus undergoes clathrin-dependent internalization long before endosomal fusion, thus minimizing the surface exposure of conserved viral epitopes during fusion and reducing the efficacy of inhibitors targeting these epitopes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm.
See full target information env

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com