JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB226447

Recombinant HPV16 E6 protein (His tag)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant HPV16 E6 protein (His tag) is a Human papillomavirus type 16 E6 Full Length protein, in the 1 to 158 aa range with >90% purity and suitable for SDS-PAGE and mass spectrometry. The predicted molecular weight of ab226447 protein is 21.2 kDa.

- Save time and ensure accurate results- use our HPV16 E6 protein as a control

View Alternative Names

Protein E6, E6

3 Images
Mass Spectrometry - Recombinant HPV16 E6 protein (His tag) (AB226447)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant HPV16 E6 protein (His tag) (AB226447)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226447 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) E6.

Mass Spectrometry - Recombinant HPV16 E6 protein (His tag) (AB226447)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant HPV16 E6 protein (His tag) (AB226447)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226447 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) E6.

SDS-PAGE - Recombinant HPV16 E6 protein (His tag) (AB226447)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant HPV16 E6 protein (His tag) (AB226447)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P03126

Animal free

No

Carrier free

No

Species

Human papillomavirus type 16

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our recombinant HPV16 E6 protein (His tag) (ab226447) as a positive control in SDS-PAGE and mass spectrometry.

The predicted molecular weight of recombinant Human papillomavirus type 16 E6 is 21.2 kDa.


Check out our protein gel staining guide for SDS-PAGE here

Sequence info

[{"sequence":"MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL","proteinLength":"Full Length","predictedMolecularWeight":"21.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":158,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P03126","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway.

Sequence similarities

Belongs to the papillomaviridae E6 protein family.

Subcellular localisation

Host nucleus

Product protocols

For this product, it's our understanding that no specific protocols are required. You can visit:

Target data

Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway.
See full target information Protein E6

Additional targets

HPV16 E6

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Frontiers in oncology 11:718781 PubMed34692493

2021

HPV16 E6 Promotes the Progression of HPV Infection-Associated Cervical Cancer by Upregulating Glucose-6-Phosphate Dehydrogenase Expression.

Applications

Unspecified application

Species

Unspecified reactive species

Ye-Fei Chang,Guo-Ji Yan,Guang-Cai Liu,Ying Hong,Hong-Lan Chen,Shui Jiang,Yong Zhong,Yan-Bin Xiyang,Tao Hu

International journal of molecular sciences 21: PubMed33076322

2020

IRF-1 Inhibits Angiogenic Activity of HPV16 E6 Oncoprotein in Cervical Cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Seung Bae Rho,Seung-Hoon Lee,Hyun-Jung Byun,Boh-Ram Kim,Chang Hoon Lee
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com