JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB53869

Recombinant Human 14-3-3 gamma/YWHAG protein (Tag Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human 14-3-3 gamma/YWHAG protein (Tag Free) is a Human Full Length protein, in the 1 to 247 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

14-3-3 protein gamma, Protein kinase C inhibitor protein 1, KCIP-1, YWHAG

1 Images
SDS-PAGE - Recombinant Human 14-3-3 gamma/YWHAG protein (Tag Free) (AB53869)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human 14-3-3 gamma/YWHAG protein (Tag Free) (AB53869)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P61981

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as 14-3-3 gamma.

Sequence info

[{"sequence":"MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN","proteinLength":"Full Length","predictedMolecularWeight":"28 kDa","actualMolecularWeight":null,"aminoAcidEnd":247,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P61981","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

14-3-3 gamma also known as YWHAG or 14-3-3 gamma protein is a member of the 14-3-3 protein family. These proteins play significant roles in signal transduction. 14-3-3 gamma is a dimeric protein with a molecular mass of about 28 to 32 kDa per monomer. It is ubiquitously expressed including in tissues such as brain muscle and heart. This protein influences a wide range of cellular processes by interacting with various signaling proteins often through recognition of phosphorylated serine or threonine motifs.
Biological function summary

Proteins within the 14-3-3 family like the 14-3-3 gamma function as adaptors and scaffolds in signal transduction pathways. They are part of multi-protein complexes that modulate interactions among proteins within the cell. 14-3-3 gamma interacts dynamically with a variety of target proteins assisting in their activities and proper localization. Its interaction facilitates cellular processes including cell cycle control apoptosis and stress response owing to its activity as a regulator of distinct signaling pathways.

Pathways

14-3-3 gamma participates in the MAPK/ERK pathway which is pivotal for cell growth and differentiation. It also plays an integral role in the PI3K/AKT pathway which contributes to survival and proliferation signals. In these pathways 14-3-3 gamma interacts with important kinases such as Raf and AKT. These interactions help transduce signals from receptors on the cell surface to the nucleus impacting gene expression and cellular responses.

Research has linked 14-3-3 gamma to neurodegenerative diseases such as Alzheimer's disease. In Alzheimer's 14-3-3 gamma interacts with proteins like tau which become abnormally phosphorylated and aggregate. Additionally this protein has associations with certain cancers where it might influence tumor growth and progression through interactions with cell cycle regulatory proteins. Its modulation of key signaling pathways makes it a candidate of interest in the development of therapeutic strategies for these diseases.

Specifications

Form

Liquid

Additional notes

Recombinant human 14-3-3 was expressed in E.coli and purified by using conventional chromatography techniques.

General info

Function

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways (PubMed : 15696159, PubMed : 16511572, PubMed : 36732624). Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif (PubMed : 15696159, PubMed : 16511572, PubMed : 36732624). Binding generally results in the modulation of the activity of the binding partner (PubMed : 16511572). Promotes inactivation of WDR24 component of the GATOR2 complex by binding to phosphorylated WDR24 (PubMed : 36732624). Participates in the positive regulation of NMDA glutamate receptor activity by promoting the L-glutamate secretion through interaction with BEST1 (PubMed : 29121962). Reduces keratinocyte intercellular adhesion, via interacting with PKP1 and sequestering it in the cytoplasm, thereby reducing its incorporation into desmosomes (PubMed : 29678907).

Sequence similarities

Belongs to the 14-3-3 family.

Post-translational modifications

Phosphorylated by various PKC isozymes.

Product protocols

Target data

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways (PubMed : 15696159, PubMed : 16511572, PubMed : 36732624). Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif (PubMed : 15696159, PubMed : 16511572, PubMed : 36732624). Binding generally results in the modulation of the activity of the binding partner (PubMed : 16511572). Promotes inactivation of WDR24 component of the GATOR2 complex by binding to phosphorylated WDR24 (PubMed : 36732624). Participates in the positive regulation of NMDA glutamate receptor activity by promoting the L-glutamate secretion through interaction with BEST1 (PubMed : 29121962). Reduces keratinocyte intercellular adhesion, via interacting with PKP1 and sequestering it in the cytoplasm, thereby reducing its incorporation into desmosomes (PubMed : 29678907).
See full target information YWHAG

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com