JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276325

Recombinant Human 14-3-3 sigma/SFN protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human 14-3-3 sigma/SFN protein (Tagged) is a Human Full Length protein, in the 1 to 248 aa range, expressed in Escherichia coli, with >94%, suitable for SDS-PAGE.

View Alternative Names

HME1, SFN, 14-3-3 protein sigma, Epithelial cell marker protein 1, Stratifin

1 Images
SDS-PAGE - Recombinant Human 14-3-3 sigma/SFN protein (Tagged) (AB276325)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human 14-3-3 sigma/SFN protein (Tagged) (AB276325)

SDS-PAGE analysis of ab276325

Key facts

Purity

>94% SDS-PAGE

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P31947

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.31% Glutathione, 0.24% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS","proteinLength":"Full Length","predictedMolecularWeight":"50.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":248,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P31947","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The 14-3-3 sigma protein also known as SFN is a member of the 14-3-3 family of proteins. It plays a major role in cellular processes by regulating various signaling pathways. This protein has a molecular mass of about 28 kDa. The expression of 14-3-3 sigma is most notable in epithelial cells and it participates in cell cycle control. It interacts with a wide range of signaling molecules emphasizing its involvement in cellular regulation.
Biological function summary

14-3-3 sigma contributes to cell cycle arrest and apoptosis. As part of a complex it interacts with other proteins to ensure proper cell division and prevent abnormal growth. It binds to phosphorylated serine/threonine residues on its target proteins influencing their activity and function. By doing this it exerts control over cell cycle checkpoints and influences DNA damage response mechanisms.

Pathways

14-3-3 sigma interacts with several pathways that are critical for maintaining cell stability and response to stress. It participates in the PI3K/AKT pathway working closely with proteins like AKT1 to facilitate cell survival and growth suppression under stress conditions. Its involvement in this pathway ties it to the regulation of cell proliferation and survival interconnecting with broader cellular networks.

Disruptions in 14-3-3 sigma function are linked to cancer and neurodegenerative diseases. In cancer its downregulation or loss leads to unchecked cell division contributing to tumor progression. In neurodegenerative diseases such as Alzheimer's the protein's interaction with tau phosphorylation processes affects disease progression. Furthermore it interacts with proteins like p53 emphasizing its role in tumor suppression and cellular stress responses.

Specifications

Form

Lyophilized

General info

Function

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways (PubMed : 15731107, PubMed : 22634725, PubMed : 28202711, PubMed : 37797010). Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif (PubMed : 15731107, PubMed : 22634725, PubMed : 28202711, PubMed : 37797010). Binding generally results in the modulation of the activity of the binding partner (PubMed : 15731107, PubMed : 22634725, PubMed : 28202711, PubMed : 37797010). Promotes cytosolic retention of GBP1 GTPase by binding to phosphorylated GBP1, thereby inhibiting the innate immune response (PubMed : 37797010). Also acts as a TP53/p53-regulated inhibitor of G2/M progression (PubMed : 9659898). When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway (By similarity). Acts to maintain desmosome cell junction adhesion in epithelial cells via interacting with and sequestering PKP3 to the cytoplasm, thereby restricting its translocation to existing desmosome structures and therefore maintaining desmosome protein homeostasis (PubMed : 24124604). Also acts to facilitate PKP3 exchange at desmosome plaques, thereby maintaining keratinocyte intercellular adhesion (PubMed : 29678907). May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53 (PubMed : 18382127).

Sequence similarities

Belongs to the 14-3-3 family.

Post-translational modifications

Ubiquitinated. Ubiquitination by RFFL induces proteasomal degradation and indirectly regulates p53/TP53 activation.

Subcellular localisation

Nucleus

Product protocols

Target data

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways (PubMed : 15731107, PubMed : 22634725, PubMed : 28202711, PubMed : 37797010). Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif (PubMed : 15731107, PubMed : 22634725, PubMed : 28202711, PubMed : 37797010). Binding generally results in the modulation of the activity of the binding partner (PubMed : 15731107, PubMed : 22634725, PubMed : 28202711, PubMed : 37797010). Promotes cytosolic retention of GBP1 GTPase by binding to phosphorylated GBP1, thereby inhibiting the innate immune response (PubMed : 37797010). Also acts as a TP53/p53-regulated inhibitor of G2/M progression (PubMed : 9659898). When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway (By similarity). Acts to maintain desmosome cell junction adhesion in epithelial cells via interacting with and sequestering PKP3 to the cytoplasm, thereby restricting its translocation to existing desmosome structures and therefore maintaining desmosome protein homeostasis (PubMed : 24124604). Also acts to facilitate PKP3 exchange at desmosome plaques, thereby maintaining keratinocyte intercellular adhesion (PubMed : 29678907). May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53 (PubMed : 18382127).
See full target information SFN

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com