JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB196053

Recombinant Human 15 Lipoxygenase 1 protein (DDDDK tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human 15 Lipoxygenase 1 protein (DDDDK tag N-Terminus) is a Human Full Length protein, in the 2 to 662 aa range, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

LOG15, ALOX15, Polyunsaturated fatty acid lipoxygenase ALOX15, 12/15-lipoxygenase, Arachidonate 15-lipoxygenase, Arachidonate omega-6 lipoxygenase, Hepoxilin A3 synthase Alox15, Linoleate 13S-lipoxygenase, 12-LOX, 15-LOX, 15-LOX-1

1 Images
SDS-PAGE - Recombinant Human 15 Lipoxygenase 1 protein (DDDDK tag N-Terminus) (AB196053)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human 15 Lipoxygenase 1 protein (DDDDK tag N-Terminus) (AB196053)

SDS-PAGE analysis of ab196053.

Key facts

Purity

>90% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

DDDDK tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P16050

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.8% Sodium chloride, 0.79% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":662,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P16050","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

15-Lipoxygenase 1 also known as 15-LOX-1 is an enzyme with significant mechanical roles in the human body. Its main function is to catalyze the oxidation of fatty acids especially converting arachidonic acid to 15-hydroperoxyeicosatetraenoic acid (15-HPETE). The protein has other names like arachidonate 15-lipoxygenase or 15-LO. The molecular weight of 15-LOX-1 is approximately 75 kDa. It is mainly expressed in cells of the reticulocyte and tracheobronchial epithelium as well as in macrophages and eosinophils.
Biological function summary

15-Lipoxygenase 1 plays a role in the immune and inflammatory responses. It is involved in lipid mediator biosynthesis producing reactive lipids that influence cell signaling and modulate reactions to inflammation. 15-LOX-1 acts as part of a complex with other enzymes within the lipoxygenase family which includes 5-lipoxygenase and 12-lipoxygenase. This enzyme can also be important for cell maturity and has roles in cell differentiation and maturation particularly in inflamed tissues.

Pathways

Several significant processes involve 15-Lipoxygenase 1 especially its part in the arachidonic acid metabolism and the linoleic acid pathway. In these pathways 15-LOX-1 transforms substances into various lipid signaling molecules like lipoxins and resolvins. These molecules have connections with other proteins like cyclooxygenase-2 (COX-2) and 5-LO which participate in the synthesis of other eicosanoids. The interplay of these pathways and proteins helps in regulating inflammation and resolving it ensuring a balanced biological response to stimuli.

15-Lipoxygenase 1 has associations with conditions including asthma and atherosclerosis. In asthma the enzyme contributes to the inflammatory changes observed in affected airways. Its involvement in this respiratory disorder links it with proteins such as LTC4 synthase that generate pro-inflammatory leukotrienes. In atherosclerosis 15-LOX-1 interacts with oxidized low-density lipoprotein (LDL) in arterial walls which contributes to plaque formation and the associated chronic inflammation. These roles reveal the enzyme's significance in both chronic inflammation and cardiovascular disease settings.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators (PubMed : 17052953, PubMed : 1944593, PubMed : 24282679, PubMed : 25293588, PubMed : 32404334, PubMed : 8334154). It inserts peroxyl groups at C12 or C15 of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) producing both 12-hydroperoxyeicosatetraenoate/12-HPETE and 15-hydroperoxyeicosatetraenoate/15-HPETE (PubMed : 17052953, PubMed : 1944593, PubMed : 24282679, PubMed : 8334154). It may then act on 12-HPETE to produce hepoxilins, which may show pro-inflammatory properties (By similarity). Can also peroxidize linoleate ((9Z,12Z)-octadecadienoate) to 13-hydroperoxyoctadecadienoate/13-HPODE (PubMed : 8334154). May participate in the sequential oxidations of DHA ((4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate) to generate specialized pro-resolving mediators (SPMs)like resolvin D5 ((7S,17S)-diHPDHA) and (7S,14S)-diHPDHA, that actively down-regulate the immune response and have anti-aggregation properties with platelets (PubMed : 32404334). Can convert epoxy fatty acids to hydroperoxy-epoxides derivatives followed by an intramolecular nucleophilic substitution leading to the formation of monocyclic endoperoxides (PubMed : 25293588). Plays an important role during the maintenance of self-tolerance by peroxidizing membrane-bound phosphatidylethanolamine which can then signal the sorting process for clearance of apoptotic cells during inflammation and prevent an autoimmune response. In addition to its role in the immune and inflammatory responses, this enzyme may play a role in epithelial wound healing in the cornea through production of lipoxin A4 (LXA(4)) and docosahexaenoic acid-derived neuroprotectin D1 (NPD1; 10R,17S-HDHA), both lipid autacoids exhibit anti-inflammatory and neuroprotective properties. Furthermore, it may regulate actin polymerization which is crucial for several biological processes such as the phagocytosis of apoptotic cells. It is also implicated in the generation of endogenous ligands for peroxisome proliferator activated receptor (PPAR-gamma), hence modulating macrophage development and function. It may also exert a negative effect on skeletal development by regulating bone mass through this pathway. As well as participates in ER stress and downstream inflammation in adipocytes, pancreatic islets, and liver (By similarity). Finally, it is also involved in the cellular response to IL13/interleukin-13 (PubMed : 21831839).

Sequence similarities

Belongs to the lipoxygenase family.

Product protocols

Target data

Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators (PubMed : 17052953, PubMed : 1944593, PubMed : 24282679, PubMed : 25293588, PubMed : 32404334, PubMed : 8334154). It inserts peroxyl groups at C12 or C15 of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) producing both 12-hydroperoxyeicosatetraenoate/12-HPETE and 15-hydroperoxyeicosatetraenoate/15-HPETE (PubMed : 17052953, PubMed : 1944593, PubMed : 24282679, PubMed : 8334154). It may then act on 12-HPETE to produce hepoxilins, which may show pro-inflammatory properties (By similarity). Can also peroxidize linoleate ((9Z,12Z)-octadecadienoate) to 13-hydroperoxyoctadecadienoate/13-HPODE (PubMed : 8334154). May participate in the sequential oxidations of DHA ((4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate) to generate specialized pro-resolving mediators (SPMs)like resolvin D5 ((7S,17S)-diHPDHA) and (7S,14S)-diHPDHA, that actively down-regulate the immune response and have anti-aggregation properties with platelets (PubMed : 32404334). Can convert epoxy fatty acids to hydroperoxy-epoxides derivatives followed by an intramolecular nucleophilic substitution leading to the formation of monocyclic endoperoxides (PubMed : 25293588). Plays an important role during the maintenance of self-tolerance by peroxidizing membrane-bound phosphatidylethanolamine which can then signal the sorting process for clearance of apoptotic cells during inflammation and prevent an autoimmune response. In addition to its role in the immune and inflammatory responses, this enzyme may play a role in epithelial wound healing in the cornea through production of lipoxin A4 (LXA(4)) and docosahexaenoic acid-derived neuroprotectin D1 (NPD1; 10R,17S-HDHA), both lipid autacoids exhibit anti-inflammatory and neuroprotective properties. Furthermore, it may regulate actin polymerization which is crucial for several biological processes such as the phagocytosis of apoptotic cells. It is also implicated in the generation of endogenous ligands for peroxisome proliferator activated receptor (PPAR-gamma), hence modulating macrophage development and function. It may also exert a negative effect on skeletal development by regulating bone mass through this pathway. As well as participates in ER stress and downstream inflammation in adipocytes, pancreatic islets, and liver (By similarity). Finally, it is also involved in the cellular response to IL13/interleukin-13 (PubMed : 21831839).
See full target information ALOX15

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com