JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114363

Recombinant Human 5-HT2C Receptor protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human 5-HT2C Receptor protein (GST tag N-Terminus) is a Human Fragment protein, in the 1 to 52 aa range, expressed in Wheat germ, with >99%, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

HTR1C, HTR2C, 5-hydroxytryptamine receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine receptor 1C, Serotonin receptor 2C, 5-HT-1C, 5-HT1C

1 Images
SDS-PAGE - Recombinant Human 5-HT2C Receptor protein (GST tag N-Terminus) (AB114363)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human 5-HT2C Receptor protein (GST tag N-Terminus) (AB114363)

12.5% SDS-PAGE showing ab114363 at approximately 31.35kDa stained with Coomassie Blue.

Key facts

Purity

>99%

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

P28335

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein).</p>" } } }

Sequence info

[{"sequence":"MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV","proteinLength":"Fragment","predictedMolecularWeight":"31.35 kDa","actualMolecularWeight":null,"aminoAcidEnd":52,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P28335","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The 5-HT2C receptor also known as 5-hydroxytryptamine receptor 2C is a G-protein coupled receptor in the serotonin receptor family. It has a mass of approximately 51 kDa. This receptor primarily expresses in the central nervous system including regions like the choroid plexus. Researchers note the 5-HT2C receptor's significant presence in areas responsible for regulating mood and cognition making it a critical player in neurotransmitter systems.
Biological function summary

The 5-HT2C receptor plays a role in modulating neurotransmitter release. It is not part of a multi-subunit complex; instead it directly interacts with G proteins to exert its function. Upon activation by serotonin the receptor can influence the release of other neurotransmitters such as dopamine and norepinephrine. This interaction impacts various physiological processes including appetite control mood regulation and anxiety management.

Pathways

One finds the 5-HT2C receptor involved in the serotonin signaling pathway contributing to mood and behavior regulation. The receptor links to the phosphatidylinositol signaling pathway where it engages proteins like phospholipase C. This connection is important for cellular responses to external stimuli. The 5-HT2C receptor also has relationships with other serotonin receptors like 5-HT2B which share similar signaling mechanisms within these pathways.

The 5-HT2C receptor has associations with conditions such as depression and obesity. Its regulatory role in neurotransmitter release influences mood disorders by affecting serotonin levels. Research has shown that the receptor connects with proteins like dopamine transporter which are relevant in the context of psychiatric disorders. In obesity altered receptor activity may affect appetite and energy balance contributing to weight regulation challenges.

Specifications

Form

Liquid

Additional notes

Purification: Glutathione Sepharose 4 Fast Flow

General info

Function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed : 12970106, PubMed : 18703043, PubMed : 19057895, PubMed : 29398112, PubMed : 7895773). Also functions as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI) and lysergic acid diethylamide (LSD) (PubMed : 19057895, PubMed : 29398112). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors (PubMed : 18703043, PubMed : 29398112). HTR2C is coupled to G(q)/G(11) G alpha proteins and activates phospholipase C-beta, releasing diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) second messengers that modulate the activity of phosphatidylinositol 3-kinase and promote the release of Ca(2+) ions from intracellular stores, respectively (PubMed : 18703043, PubMed : 29398112). Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways (PubMed : 29398112). Regulates neuronal activity via the activation of short transient receptor potential calcium channels in the brain, and thereby modulates the activation of pro-opiomelanocortin neurons and the release of CRH that then regulates the release of corticosterone (By similarity). Plays a role in the regulation of appetite and eating behavior, responses to anxiogenic stimuli and stress (By similarity). Plays a role in insulin sensitivity and glucose homeostasis (By similarity).

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Post-translational modifications

N-glycosylated.

Product protocols

Target data

G-protein coupled receptor for 5-hydroxytryptamine (serotonin) (PubMed : 12970106, PubMed : 18703043, PubMed : 19057895, PubMed : 29398112, PubMed : 7895773). Also functions as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI) and lysergic acid diethylamide (LSD) (PubMed : 19057895, PubMed : 29398112). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors (PubMed : 18703043, PubMed : 29398112). HTR2C is coupled to G(q)/G(11) G alpha proteins and activates phospholipase C-beta, releasing diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) second messengers that modulate the activity of phosphatidylinositol 3-kinase and promote the release of Ca(2+) ions from intracellular stores, respectively (PubMed : 18703043, PubMed : 29398112). Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways (PubMed : 29398112). Regulates neuronal activity via the activation of short transient receptor potential calcium channels in the brain, and thereby modulates the activation of pro-opiomelanocortin neurons and the release of CRH that then regulates the release of corticosterone (By similarity). Plays a role in the regulation of appetite and eating behavior, responses to anxiogenic stimuli and stress (By similarity). Plays a role in insulin sensitivity and glucose homeostasis (By similarity).
See full target information HTR2C

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com