JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112316

Recombinant Human 67kDa Laminin Receptor protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human 67kDa Laminin Receptor protein is a Human Fragment protein, in the 196 to 295 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

LAMBR, LAMR1, RPSA, Small ribosomal subunit protein uS2, 37 kDa laminin receptor precursor, 37/67 kDa laminin receptor, 40S ribosomal protein SA, 67 kDa laminin receptor, Colon carcinoma laminin-binding protein, Laminin receptor 1, Laminin-binding protein precursor p40, Multidrug resistance-associated protein MGr1-Ag, NEM/1CHD4, 37LRP, LRP/LR, 67LR, LamR, LBP/p40

1 Images
SDS-PAGE - Recombinant Human 67kDa Laminin Receptor protein (AB112316)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human 67kDa Laminin Receptor protein (AB112316)

ab112316 on a 12.5% SDS-PAGE Stained with Coomassie Blue

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P08865

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":295,"aminoAcidStart":196,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P08865","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The 67kDa Laminin Receptor also known as the laminin binding protein or protein laminin functions as a receptor for laminin an important component of the extracellular matrix. This receptor is expressed in many tissue types serving an important mechanical role by mediating the adhesion and migration of cells. The receptor anchors cells to laminin molecules thereby influencing cell differentiation and proliferation. The molecular weight of the laminin receptor is approximately 67 kilodaltons which signifies it as a critical player in various cellular processes.
Biological function summary

This receptor engages in cellular interactions that are essential for maintaining the integrity and architecture of tissues. It often associates with other proteins to form complexes which further strengthen its functional capabilities. By anchoring laminin to the cell surface it regulates cell signaling pathways that influence cell motility invasion and survival. These interactions suggest that the 67kDa Laminin Receptor's function goes beyond simple adhesion impacting cellular responsiveness to external matrix cues.

Pathways

The receptor influences the MAPK and PI3K/Akt signaling pathways which are significant in cell survival and proliferation. Through such pathways it interacts with numerous proteins including integrins and fibronectin receptors facilitating orchestrated cell signaling. This connectivity highlights the receptor's role in cellular communication networks contributing to dynamic processes like wound healing and angiogenesis.

Aberrant expression of the 67kDa Laminin Receptor relates to conditions such as cancer and Alzheimer's disease. In cancer its overexpression links to increased tumor invasiveness likely due to enhanced cell motility mediated through integrin interactions. In Alzheimer's disease its relationship with amyloid precursor protein influences plaque formation exacerbating disease progression. Understanding these connections highlights potential therapeutic targets for disease intervention.

Specifications

Form

Liquid

General info

Function

Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Acts as a PPP1R16B-dependent substrate of PPP1CA.. (Microbial infection) Acts as a receptor for the Adeno-associated viruses 2,3,8 and 9.. (Microbial infection) Acts as a receptor for the Dengue virus.. (Microbial infection) Acts as a receptor for the Sindbis virus.. (Microbial infection) Acts as a receptor for the Venezuelan equine encephalitis virus.. (Microbial infection) Acts as a receptor for the pathogenic prion protein.. (Microbial infection) Acts as a receptor for bacteria.

Sequence similarities

Belongs to the universal ribosomal protein uS2 family.

Post-translational modifications

Acylated. Acylation may be a prerequisite for conversion of the monomeric 37 kDa laminin receptor precursor (37LRP) to the mature dimeric 67 kDa laminin receptor (67LR), and may provide a mechanism for membrane association (PubMed:9581863).. Cleaved by stromelysin-3 (ST3) at the cell surface. Cleavage by stromelysin-3 may be a mechanism to alter cell-extracellular matrix interactions.

Subcellular localisation

Nucleus

Product protocols

Target data

Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis. Acts as a PPP1R16B-dependent substrate of PPP1CA.. (Microbial infection) Acts as a receptor for the Adeno-associated viruses 2,3,8 and 9.. (Microbial infection) Acts as a receptor for the Dengue virus.. (Microbial infection) Acts as a receptor for the Sindbis virus.. (Microbial infection) Acts as a receptor for the Venezuelan equine encephalitis virus.. (Microbial infection) Acts as a receptor for the pathogenic prion protein.. (Microbial infection) Acts as a receptor for bacteria.
See full target information RPSA

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Cancer biology & therapy 16:724-32 PubMed25799942

2015

Monoclonal antibodies specific for oncofetal antigen--immature laminin receptor protein: Effects on tumor growth and spread in two murine models.

Applications

Unspecified application

Species

Unspecified reactive species

Shannon D McClintock,Roscoe L Warner,Saqib Ali,Apurupa Chekuri,Michael K Dame,Durga Attili,Randall K Knibbs,Muhammad Nadeem Aslam,Joseph Sinkule,Alton Charles Morgan,Adel Barsoum,Lauren B Smith,David G Beer,Kent J Johnson,James Varani
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com