JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114660

Recombinant Human ABCA4 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ABCA4 protein is a Human Fragment protein, in the 2174 to 2273 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

ABCR, ABCA4, Retinal-specific phospholipid-transporting ATPase ABCA4, ATP-binding cassette sub-family A member 4, RIM ABC transporter, Retinal-specific ATP-binding cassette transporter, Stargardt disease protein, RIM proteinv, RmP

1 Images
SDS-PAGE - Recombinant Human ABCA4 protein (AB114660)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ABCA4 protein (AB114660)

SDS-PAGE analysis of ab114660 on a 12.5% gel stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

P78363

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"PKDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSSSLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTESHDLPLHPRAAGASRQAQD","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":2273,"aminoAcidStart":2174,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P78363","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The ABCA4 protein also known as ATP-binding cassette sub-family A member 4 is a large transporter protein with a molecular mass of around 250 kDa. It is located primarily in the retina specifically in the photoreceptor cells where it plays a critical role in the visual cycle. ABCA4 helps transport N-retinylidene-phosphatidylethanolamine and other retinoid compounds across photoreceptor disc membranes. This function is essential in maintaining the photoreceptors' integrity and function.
Biological function summary

ABCA4 has an important function in the clearance of retinal pigments and it operates as part of a larger complex with other visual cycle proteins. Its activity prevents the accumulation of toxic substances that can damage photoreceptors. ABCA4's transport activity is ATP-dependent meaning it requires energy from ATP hydrolysis to perform its duties. This energy consumption highlights the protein's dynamic role in retinal health and visual processes.

Pathways

ABCA4 is an important component in the visual cycle and the retinoid cycle pathway in rods and cones. These pathways are vital for regenerating visual pigments and ensuring proper vision. ABCA4 works alongside related proteins like RPE65 and RDH12 both of which also contribute to retinoid processing and photoreceptor function. The proper flow of retinoids and prevention of toxic buildup depend heavily on ABCA4 and these associated proteins.

ABCA4 is closely linked with Stargardt disease and age-related macular degeneration. Mutations in the ABCA4 gene disrupt its normal function leading to the accumulation of toxic retinoid byproducts that damage photoreceptor cells and impair vision. Such mutations connect ABCA4 with proteins like CRALBP and LRAT whose dysfunctions similarly affect the visual cycle contributing to the progression of retinal diseases.

Specifications

Form

Liquid

General info

Function

Flippase that catalyzes in an ATP-dependent manner the transport of retinal-phosphatidylethanolamine conjugates like the 11-cis and all-trans isomers of N-retinylidene-phosphatidylethanolamine from the lumen to the cytoplasmic leaflet of photoreceptor outer segment disk membranes, where N-cis-retinylidene-phosphatidylethanolamine (N-cis-R-PE) is then isomerized to its all-trans isomer (N-trans-R-PE) and reduced by RDH8 to produce all-trans-retinol (all-trans-rol) and therefore prevents the accumulation of excess of 11-cis-retinal and its schiff-base conjugate and the formation of toxic bisretinoid (PubMed : 10075733, PubMed : 20404325, PubMed : 22735453, PubMed : 23144455, PubMed : 24097981, PubMed : 29847635, PubMed : 33375396). May display both ATPase and GTPase activity that is strongly influenced by the lipid environment and the presence of retinoid compounds (PubMed : 22735453). Binds the unprotonated form of N-retinylidene-phosphatidylethanolamine with high affinity in the absence of ATP, and ATP binding and hydrolysis induce a protein conformational change that causes the dissociation of N-retinylidene-phosphatidylethanolamine (By similarity).

Sequence similarities

Belongs to the ABC transporter superfamily. ABCA family.

Post-translational modifications

Proteolytic cleavage by trypsin leads to a 120-kDa N-terminal fragment and a 115-kDa C-terminal fragment that are linked through disulfide bonds.. N-glycosylated.. Phosphorylation is independent of light exposure and modulates ATPase activity.

Product protocols

Target data

Flippase that catalyzes in an ATP-dependent manner the transport of retinal-phosphatidylethanolamine conjugates like the 11-cis and all-trans isomers of N-retinylidene-phosphatidylethanolamine from the lumen to the cytoplasmic leaflet of photoreceptor outer segment disk membranes, where N-cis-retinylidene-phosphatidylethanolamine (N-cis-R-PE) is then isomerized to its all-trans isomer (N-trans-R-PE) and reduced by RDH8 to produce all-trans-retinol (all-trans-rol) and therefore prevents the accumulation of excess of 11-cis-retinal and its schiff-base conjugate and the formation of toxic bisretinoid (PubMed : 10075733, PubMed : 20404325, PubMed : 22735453, PubMed : 23144455, PubMed : 24097981, PubMed : 29847635, PubMed : 33375396). May display both ATPase and GTPase activity that is strongly influenced by the lipid environment and the presence of retinoid compounds (PubMed : 22735453). Binds the unprotonated form of N-retinylidene-phosphatidylethanolamine with high affinity in the absence of ATP, and ATP binding and hydrolysis induce a protein conformational change that causes the dissociation of N-retinylidene-phosphatidylethanolamine (By similarity).
See full target information ABCA4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com