JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB160761

Recombinant Human Abi-1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Abi-1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 185 to 238 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

SSH3BP1, ABI1, Abl interactor 1, Abelson interactor 1, Abl-binding protein 4, Eps8 SH3 domain-binding protein, Nap1-binding protein, Spectrin SH3 domain-binding protein 1, e3B1, Abi-1, AblBP4, Eps8-binding protein, Nap1BP

1 Images
SDS-PAGE - Recombinant Human Abi-1 protein (GST tag N-Terminus) (AB160761)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Abi-1 protein (GST tag N-Terminus) (AB160761)

ab160761 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q8IZP0

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSS","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":238,"aminoAcidStart":185,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q8IZP0","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Abi-1 protein also known as ABI family member 1 is a small adapter protein with a molecular mass of about 55 kDa. It is mainly expressed in brain and hematopoietic tissues. Abi-1 contains several domains allowing it to interact with a variety of signaling and cytoskeletal proteins. Its role as a linker connects various cellular components and facilitates communication between them important for the dynamic regulation of the actin cytoskeleton.
Biological function summary

Abi-1 influences actin polymerization and cell motility by associating with the WAVE complex. This complex plays an important function in mediating signal transduction from small GTPases to the actin cytoskeleton. Abi-1 helps to organize the cytoskeleton to enable cell movements and morphological changes. Moreover Abi-1 is involved in the regulation of signaling pathways linked with cell growth and differentiation. These functions position Abi-1 as an important factor in maintaining normal cellular function.

Pathways

Abi-1 operates inside the WAVE regulatory complex which affects the Rac1 signaling pathway. This pathway is essential for actin polymerization and cellular migration and involves proteins like N-WASP and Arp2/3 complex. Through its interaction with Rac1 and associated proteins Abi-1 greatly affects cytoskeletal reorganization demonstrating its importance in normal cellular movement and immune cell function.

Alterations in Abi-1 have associations with cancer particularly in leukemia. Abi-1 plays a role in oncogenic processes by interacting with proteins like BCR-ABL which is implicated in the pathogenesis of chronic myeloid leukemia. Additionally Abi-1 can contribute to neurological disorders due to its expression in brain tissues but the mechanisms remain less clearly understood. The disorder-associated signaling dynamics make Abi-1 a promising research focus for therapeutic interventions.

Specifications

Form

Liquid

General info

Function

May act in negative regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. May play a role in regulation of EGF-induced Erk pathway activation. Involved in cytoskeletal reorganization and EGFR signaling. Together with EPS8 participates in transduction of signals from Ras to Rac. In vitro, a trimeric complex of ABI1, EPS8 and SOS1 exhibits Rac specific guanine nucleotide exchange factor (GEF) activity and ABI1 seems to act as an adapter in the complex. Regulates ABL1/c-Abl-mediated phosphorylation of ENAH. Recruits WASF1 to lamellipodia and there seems to regulate WASF1 protein level. In brain, seems to regulate the dendritic outgrowth and branching as well as to determine the shape and number of synaptic contacts of developing neurons.

Sequence similarities

Belongs to the ABI family.

Post-translational modifications

Phosphorylated on tyrosine residues after serum stimulation or induction by v-Abl. Seems to be phosphorylated at Tyr-53 by ABL1, required for nuclear but not for synaptic localization.

Product protocols

Target data

May act in negative regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. May play a role in regulation of EGF-induced Erk pathway activation. Involved in cytoskeletal reorganization and EGFR signaling. Together with EPS8 participates in transduction of signals from Ras to Rac. In vitro, a trimeric complex of ABI1, EPS8 and SOS1 exhibits Rac specific guanine nucleotide exchange factor (GEF) activity and ABI1 seems to act as an adapter in the complex. Regulates ABL1/c-Abl-mediated phosphorylation of ENAH. Recruits WASF1 to lamellipodia and there seems to regulate WASF1 protein level. In brain, seems to regulate the dendritic outgrowth and branching as well as to determine the shape and number of synaptic contacts of developing neurons.
See full target information ABI1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com