JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB195158

Recombinant Human ACF1 / BAZ1A protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ACF1 / BAZ1A protein (GST tag N-Terminus) is a Human Fragment protein, in the 1415 to 1545 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

ACF1, WCRF180, HSPC317, BAZ1A, Bromodomain adjacent to zinc finger domain protein 1A, ATP-dependent chromatin-remodeling protein, ATP-utilizing chromatin assembly and remodeling factor 1, CHRAC subunit ACF1, Williams syndrome transcription factor-related chromatin-remodeling factor 180, hWALp1, hACF1

1 Images
SDS-PAGE - Recombinant Human ACF1 / BAZ1A protein (GST tag N-Terminus) (AB195158)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human ACF1 / BAZ1A protein (GST tag N-Terminus) (AB195158)

4-20% SDS-PAGE using of 2.7 μg ab195158. Coomassie staining.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9NRL2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEPSPVTLGRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQV","proteinLength":"Fragment","predictedMolecularWeight":"42 kDa","actualMolecularWeight":null,"aminoAcidEnd":1545,"aminoAcidStart":1415,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9NRL2","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ACF1 also known as BAZ1A is a protein involved in DNA regulation. It is part of the ATP-utilizing chromatin assembly and remodeling factor (ACF) complex. This protein with a molecular mass of around 216 kDa is present mostly in the nucleus. ACF1 shows expression in various tissues including the brain and liver where it operates in regulating chromatin structure and gene accessibility.
Biological function summary

ACF1/BAZ1A is integral to chromatin remodeling which affects how DNA is packaged and accessed by other cellular machinery. It forms part of the ACF complex alongside the ISWI ATPase subunit heavily impacting nucleosome spacing and accessibility. ACF1/BAZ1A assists in nucleosome assembly and the establishment of regular chromatin structures important for gene expression regulation DNA replication and repair processes.

Pathways

ACF1/BAZ1A plays essential roles in pathways related to DNA repair and transcription regulation. In the DNA damage response pathway ACF1/BAZ1A works alongside other proteins like ISWI to ensure proper chromatin architecture facilitating DNA synthesis and repair mechanisms. It also contributes to transcription regulation by altering chromatin structure to allow transcription factors and RNA polymerase II access to DNA.

ACF1/BAZ1A associates with conditions involving genomic instability and cancer. Its role in chromatin remodeling makes it relevant in cancer where faulty chromatin regulation can lead to unchecked cell proliferation. ACF1/BAZ1A has connections with p53 a protein significant in the cellular response to DNA damage further implicating its importance in maintaining genomic integrity. Understanding this protein's role could aid therapeutic strategies targeting chromatin dynamics in these diseases.

Specifications

Form

Liquid

General info

Function

Regulatory subunit of the ATP-dependent ACF-1 and ACF-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and slide edge- and center-positioned histone octamers away from their original location on the DNA template to facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed : 17099699, PubMed : 28801535). Both complexes regulate the spacing of nucleosomes along the chromatin and have the ability to slide mononucleosomes to the center of a DNA template in an ATP-dependent manner (PubMed : 14759371, PubMed : 17099699, PubMed : 28801535). The ACF-1 ISWI chromatin remodeling complex has a lower ATP hydrolysis rate than the ACF-5 ISWI chromatin remodeling complex (PubMed : 28801535). Has a role in sensing the length of DNA which flank nucleosomes, which modulates the nucleosome spacing activity of the ACF-5 ISWI chromatin remodeling complex (PubMed : 17099699). Involved in DNA replication and together with SMARCA5/SNF2H is required for replication of pericentric heterochromatin in S-phase (PubMed : 12434153). May have a role in nuclear receptor-mediated transcription repression (PubMed : 17519354).

Sequence similarities

Belongs to the WAL family.

Subcellular localisation

Nucleus

Product protocols

Target data

Regulatory subunit of the ATP-dependent ACF-1 and ACF-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and slide edge- and center-positioned histone octamers away from their original location on the DNA template to facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed : 17099699, PubMed : 28801535). Both complexes regulate the spacing of nucleosomes along the chromatin and have the ability to slide mononucleosomes to the center of a DNA template in an ATP-dependent manner (PubMed : 14759371, PubMed : 17099699, PubMed : 28801535). The ACF-1 ISWI chromatin remodeling complex has a lower ATP hydrolysis rate than the ACF-5 ISWI chromatin remodeling complex (PubMed : 28801535). Has a role in sensing the length of DNA which flank nucleosomes, which modulates the nucleosome spacing activity of the ACF-5 ISWI chromatin remodeling complex (PubMed : 17099699). Involved in DNA replication and together with SMARCA5/SNF2H is required for replication of pericentric heterochromatin in S-phase (PubMed : 12434153). May have a role in nuclear receptor-mediated transcription repression (PubMed : 17519354).
See full target information BAZ1A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com