JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB157846

Recombinant Human Activin A Receptor Type IB/ALK-4 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Activin A Receptor Type IB/ALK-4 protein (GST tag N-Terminus) is a Human Fragment protein, in the 24 to 126 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

ACVRLK4, ALK4, ACVR1B, Activin receptor type-1B, Activin receptor type IB, Activin receptor-like kinase 4, Serine/threonine-protein kinase receptor R2, ACTR-IB, ALK-4, SKR2

1 Images
SDS-PAGE - Recombinant Human Activin A Receptor Type IB/ALK-4 protein (GST tag N-Terminus) (AB157846)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Activin A Receptor Type IB/ALK-4 protein (GST tag N-Terminus) (AB157846)

ab157846 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P36896

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Activin A Receptor Type IB.

Sequence info

[{"sequence":"SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":126,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P36896","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Activin A Receptor Type IB also known as ACVR1B or ALK-4 is a serine/threonine kinase involved in the TGF-beta superfamily signaling. This receptor has a molecular mass of approximately 54 kDa and is expressed in a variety of tissues including the brain heart and reproductive organs. ALK-4 specifically interacts with type II activin receptors to mediate the signal transduction processes that are critical for cell differentiation and growth.
Biological function summary

ALK-4 plays an important role in cell differentiation proliferation and apoptosis. It forms a complex with activin type II receptors which is essential for its proper function. This receptor mediates the signaling pathways that regulate these cellular processes having a significant impact on development and tissue homeostasis. The action of ALK-4 is important for the regulation of mesodermal differentiation and the formation of the axial skeleton during embryogenesis.

Pathways

ALK-4 is part of the TGF-beta signaling pathway and the activin signaling pathway. These pathways are vital for various cellular processes including immune response and tissue repair. In the activin pathway ALK-4 functions along with its related proteins such as ACVR2A and SMAD2/3 to propagate the signal that induces gene expression changes. This signaling cascade involves phosphorylation events that eventually lead to the regulation of target gene expression in the nucleus.

ALK-4 has associations with reproductive disorders and cancer. Dysregulation of activin signaling involving ALK-4 can contribute to disorders such as polycystic ovary syndrome (PCOS) and has implications in tumor progression and metastasis in cancer. The receptor works closely with other proteins like inhibin and follistatin which modulate activin signaling highlighting its role in pathologies related to aberrant cell proliferation and differentiation.

Specifications

Form

Liquid

General info

Function

Transmembrane serine/threonine kinase activin type-1 receptor forming an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating a many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, type-2 receptors (ACVR2A and/or ACVR2B) act as a primary activin receptors whereas the type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor such as ACVR1B. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor. ACVR1B also phosphorylates TDP2.

Sequence similarities

Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.

Post-translational modifications

Autophosphorylated. Phosphorylated by activin receptor type-2 (ACVR2A or ACVR2B) in response to activin-binding at serine and threonine residues in the GS domain. Phosphorylation of ACVR1B by activin receptor type-2 regulates association with SMAD7.. Ubiquitinated. Level of ubiquitination is regulated by the SMAD7-SMURF1 complex.. Ubiquitinated.

Product protocols

Target data

Transmembrane serine/threonine kinase activin type-1 receptor forming an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating a many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, type-2 receptors (ACVR2A and/or ACVR2B) act as a primary activin receptors whereas the type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor such as ACVR1B. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor. ACVR1B also phosphorylates TDP2.
See full target information ACVR1B

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Allergologia et immunopathologia 51:140-145 PubMed36617833

2023

LARP7 alleviates psoriasis symptoms in mice by regulating the SIRT1/NF-κB signaling pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Na Li,Yulei Liu
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com