JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB84539

Recombinant human Activin Receptor Type IA protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Activin Receptor Type IA protein is a Human Fragment protein, in the 147 to 509 aa range, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE, WB, FuncS.

View Alternative Names

ACVRLK2, ACVR1, Activin receptor type-1, Activin receptor type I, Activin receptor-like kinase 2, Serine/threonine-protein kinase receptor R1, TGF-B superfamily receptor type I, ACTR-I, ALK-2, SKR1, TSR-I

4 Images
Functional Studies - Recombinant human Activin Receptor Type IA protein (AB84539)
  • FuncS

Unknown

Functional Studies - Recombinant human Activin Receptor Type IA protein (AB84539)

The specific activity of Activin Receptor Type IA (ab84539) was determined to be 40 nmol/min/mg as per activity assay protocol

Functional Studies - Recombinant human Activin Receptor Type IA protein (AB84539)
  • FuncS

Unknown

Functional Studies - Recombinant human Activin Receptor Type IA protein (AB84539)

The specific activity of ab84539 was determined to be 46 nmol/min/mg by activity assay.

SDS-PAGE - Recombinant human Activin Receptor Type IA protein (AB84539)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human Activin Receptor Type IA protein (AB84539)

The purity of ab84539 was determined to be >90% by SDS-PAGE. Molecular Weight : 67 kDa.

SDS-PAGE - Recombinant human Activin Receptor Type IA protein (AB84539)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human Activin Receptor Type IA protein (AB84539)

SDS PAGE analysis of ab84539

Key facts

Purity

>90% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS, WB

applications

Biologically active

Yes

Biological activity

The specific activity of Activin Receptor Type IA was determined to be 46 nmol/min/mg by activity assay.

Accession

Q04771

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.79% Tris HCl, 0.00385% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.0038% EGTA, 0.00292% EDTA, 0.00174% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

ab91090 (Cow Casein full length protein) can be utilized as a substrate for assessing Kinase activity

Sequence info

[{"sequence":"LLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTD","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":509,"aminoAcidStart":147,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q04771","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Activin Receptor Type IA also known as ACVR1 or ALK2 is a type I receptor serine/threonine kinase. It has a mass of approximately 55 kDa. Activin Receptor Type IA is widely expressed in various tissues including skeletal muscle heart and central nervous system. It functions through the binding of ligands like activins and bone morphogenetic proteins (BMPs) which triggers intracellular signaling cascades important for cellular processes.
Biological function summary

Activin Receptor Type IA plays a significant role in several cellular activities including growth and differentiation. It operates as part of a receptor complex with type II receptors like ACVR2A protein which facilitates ligand binding and phosphorylation. Activin receptor is essential for the regulation of mesoderm induction and organ development notably in the skeletal and muscular systems. Its interaction with activin protein family members influences various developmental processes.

Pathways

Activin Receptor Type IA is an integral component of the TGF-beta signaling pathway and BMP pathway. These pathways are vital for embryonic development and tissue homeostasis. Activin receptor interacts with the SMAD family of proteins which mediate signal transduction to the nucleus influencing gene expression. Through these pathways it relates functionally to SMAD1 and SMAD2 proteins that contribute to cell proliferation and differentiation dynamics.

Activin Receptor Type IA is associated with fibrodysplasia ossificans progressiva (FOP) and cancer. Mutations in the ACVR1 gene can lead to abnormal bone growth seen in FOP commonly due to erroneous activation of the BMP signaling pathway. In some cancers the dysregulation of activin receptor signaling can alter cell proliferation rates placing it in connection with proteins involved in oncogenic processes. Targeting activin receptor pathways might offer therapeutic potential in certain diseases by modulating or restoring its normal signaling capability.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Bone morphogenetic protein (BMP) type I receptor that is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation (PubMed : 20628059, PubMed : 22977237). As a type I receptor, forms heterotetrameric receptor complexes with the type II receptors AMHR2, ACVR2A or ACVR2B (PubMed : 17911401). Upon binding of ligands such as BMP7 or GDF2/BMP9 to the heteromeric complexes, type II receptors transphosphorylate ACVR1 intracellular domain (PubMed : 25354296). In turn, ACVR1 kinase domain is activated and subsequently phosphorylates SMAD1/5/8 proteins that transduce the signal (PubMed : 9748228). In addition to its role in mediating BMP pathway-specific signaling, suppresses TGFbeta/activin pathway signaling by interfering with the binding of activin to its type II receptor (PubMed : 17911401). Besides canonical SMAD signaling, can activate non-canonical pathways such as p38 mitogen-activated protein kinases/MAPKs (By similarity). May promote the expression of HAMP, potentially via its interaction with BMP6 (By similarity).

Sequence similarities

Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.

Product protocols

Target data

Bone morphogenetic protein (BMP) type I receptor that is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation (PubMed : 20628059, PubMed : 22977237). As a type I receptor, forms heterotetrameric receptor complexes with the type II receptors AMHR2, ACVR2A or ACVR2B (PubMed : 17911401). Upon binding of ligands such as BMP7 or GDF2/BMP9 to the heteromeric complexes, type II receptors transphosphorylate ACVR1 intracellular domain (PubMed : 25354296). In turn, ACVR1 kinase domain is activated and subsequently phosphorylates SMAD1/5/8 proteins that transduce the signal (PubMed : 9748228). In addition to its role in mediating BMP pathway-specific signaling, suppresses TGFbeta/activin pathway signaling by interfering with the binding of activin to its type II receptor (PubMed : 17911401). Besides canonical SMAD signaling, can activate non-canonical pathways such as p38 mitogen-activated protein kinases/MAPKs (By similarity). May promote the expression of HAMP, potentially via its interaction with BMP6 (By similarity).
See full target information ACVR1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com