JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114488

Recombinant Human Activin Receptor Type IIB/ACVR2B protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Activin Receptor Type IIB/ACVR2B protein is a Human protein, in the 21 to 120 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Activin receptor type-2B, Activin receptor type IIB, ACTR-IIB, ACVR2B

1 Images
SDS-PAGE - Recombinant Human Activin Receptor Type IIB/ACVR2B protein (AB114488)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Activin Receptor Type IIB/ACVR2B protein (AB114488)

12.5% SDS-PAGE showing ab114488 at approximately 36.63kDa stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

Q13705

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein).</p>" } } }

Product details

This product was previously labelled as Activin Receptor Type IIB.

Sequence info

[{"sequence":"RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWANSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG","proteinLength":null,"predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":120,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13705","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Activin receptor type IIB (ACVR2B) also known as activin receptor type 2B or ACTR-IIB is a transmembrane serine/threonine kinase receptor. ACVR2B primarily binds activins though it can also interact with other ligands. This receptor weighs approximately 57 kDa. ACVR2B is widely expressed in various tissues including skeletal muscle heart and nervous tissue. The receptor plays an important role in transmitting signals from extracellular ligands to intracellular pathways influencing development and cellular functions.
Biological function summary

Activin receptor type IIB participates in the regulation of muscle growth by controlling the activity of growth inhibitory proteins. The receptor forms complexes with type I receptor kinases initiating signal transduction events. ACVR2B also interfaces with the inhibin α subunit in the context of reproductive biology. Its involvement in these complexes and interactions underlines its significance in modulating physiological processes such as cell proliferation and differentiation.

Pathways

Activin receptor type IIB plays a significant role in the TGF-beta signaling pathway and the myostatin pathway. These pathways regulate important cellular processes like muscular hypertrophy and tissue homeostasis. In these pathways ACVR2B interacts with proteins such as follistatin and myostatin. Follistatin acts as a binding protein modulating the activity of members in the TGF-beta superfamily including myostatin and activins highlighting ACVR2B's involvement in maintaining cellular equilibrium.

Activin receptor type IIB has links to muscular dystrophy and cancer. In muscular dystrophy the receptor's signaling affects muscle repair and regeneration primarily through its interaction with myostatin a known negative regulator of muscle growth. In cancer aberrant signaling through ACVR2B could contribute to tumor progression by affecting cellular proliferation and differentiation rates. Understanding ACVR2B's involvement in these diseases provides insights into potential therapeutic targets.

Specifications

Form

Liquid

General info

Function

Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor.

Sequence similarities

Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.

Post-translational modifications

Phosphorylated. Constitutive phosphorylation is in part catalyzed by its own kinase activity.

Product protocols

Target data

Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor.
See full target information ACVR2B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com