JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB134430

Recombinant human ADAMTS1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human ADAMTS1 protein is a Human Fragment protein, in the 253 to 616 aa range, expressed in Baculovirus infected insect cells, with >90%, suitable for SDS-PAGE, Inhib, FuncS.

View Alternative Names

KIAA1346, METH1, ADAMTS1, A disintegrin and metalloproteinase with thrombospondin motifs 1, ADAM-TS 1, ADAM-TS1, ADAMTS-1, METH-1

1 Images
SDS-PAGE - Recombinant human ADAMTS1 protein (AB134430)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human ADAMTS1 protein (AB134430)

SDS-PAGE analysis of ab134430 (2 μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Baculovirus infected insect cells

Tags

His tag C-Terminus

Applications

Inhib, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Activity of ab134430 is determined with recombinant aggrecan interglobular domain. ab134430 hydrolyzes the aggrecanase site within this domain (peptide bond E373 - A374 in Human aggrecan). The recombinant substrate is incubated at a concentration of 0.1 μM with 0.2-3.0 nM ADAMTS1 in 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2, 1 μM leupeptin, 1 μM pepstatin, 1 mM Pefabloc, 0.05 % Brij 35 for 15 min at 37°C. Cleavage at the aggrecanase-site is estimated from the appearance of the hydrolysis fragment with the novel N-terminus ARGSVIL. The fragment is quantified with two monoclonal antibodies, one directed against the neoepitope ARGSVIL, the other against the sequence C-terminal to the neoepitope. Under the specified conditions the hydrolysis rate is > 0.06 nM hydrolysed substrate/min x nM truncated ADAMTS1. When related to mg enzyme, the value is > 1.4 nmoles hydrolyzed substrate/min x mg ADAMTS1.

Accession

Q9UHI8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 0.88% Sodium chloride, 0.79% Tris HCl, 0.05% Calcium chloride, 0.05% Polyoxyethylene lauryl ether

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Inhib": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPHNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRKHFDTPFHGNWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNLEDCPDN","proteinLength":"Fragment","predictedMolecularWeight":"41 kDa","actualMolecularWeight":null,"aminoAcidEnd":616,"aminoAcidStart":253,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"Q9UHI8","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ADAMTS1 short for a disintegrin and metalloproteinase with thrombospondin motifs 1 is an enzyme with a mass of around 110 kDa. Researchers often study this enzyme for its role in protein degradation and modification. ADAMTS1 is found in various tissues including the heart lungs and kidneys. This protein has several aliases sometimes referred to as ADAMTS-1 or ADAM-TS1. Its primary function involves processing extracellular matrix components such as aggrecan and versican which contribute to tissue remodeling.
Biological function summary

The influence of ADAMTS1 extends to various physiological and developmental processes. This enzyme participates in the modulation of angiogenesis inflammation and reproductive functions. It operates within a complex of metalloproteinases coordinating the breakdown of matrix proteins. Through these activities ADAMTS1 maintains tissue integrity and homeostasis. It particularly plays an essential role in the regulation of proteoglycans which are critical in cellular communication and structure.

Pathways

The actions of ADAMTS1 intersect within the extracellular matrix organization and integrin signaling pathways. These pathways are important for cell adhesion and migration contributing to tissue morphogenesis and repair. ADAMTS1 shows interaction with proteins like integrins and other matrix metalloproteinases establishing a network critical for cellular structural changes and signal transduction. These interactions ensure balanced tissue development and response to environmental changes.

The dysfunction of ADAMTS1 has links to conditions like osteoarthritis and cancer. In osteoarthritis inadequate regulation of matrix components by ADAMTS1 can lead to joint degradation. In cancer its dysregulation may influence tumor growth and metastasis. ADAMTS1 interacts with other proteins implicated in these diseases such as aggrecanases in osteoarthritis and integrins in cancer. These connections highlight the potential role of ADAMTS1 as a therapeutic target in managing these complex diseases.

Specifications

Form

Liquid

Additional notes

ab134430 was purified from insect cell culture supernatants by affinity purification.

General info

Function

Cleaves aggrecan, a cartilage proteoglycan, at the '1938-Glu-|-Leu-1939' site (within the chondroitin sulfate attachment domain), and may be involved in its turnover (By similarity). Has angiogenic inhibitor activity. Active metalloprotease, which may be associated with various inflammatory processes as well as development of cancer cachexia. May play a critical role in follicular rupture.

Post-translational modifications

The precursor is cleaved by a furin endopeptidase.. Glycosylated. Can be O-fucosylated by POFUT2 on a serine or a threonine residue found within the consensus sequence C1-X(2)-(S/T)-C2-G of the TSP type-1 repeat domains where C1 and C2 are the first and second cysteine residue of the repeat, respectively. Fucosylated repeats can then be further glycosylated by the addition of a beta-1,3-glucose residue by the glucosyltransferase, B3GALTL. Fucosylation mediates the efficient secretion of ADAMTS family members. Can also be C-glycosylated with one or two mannose molecules on tryptophan residues within the consensus sequence W-X-X-W of the TPRs, and N-glycosylated. These other glycosylations can also facilitate secretion (By similarity).

Product protocols

Target data

Cleaves aggrecan, a cartilage proteoglycan, at the '1938-Glu-|-Leu-1939' site (within the chondroitin sulfate attachment domain), and may be involved in its turnover (By similarity). Has angiogenic inhibitor activity. Active metalloprotease, which may be associated with various inflammatory processes as well as development of cancer cachexia. May play a critical role in follicular rupture.
See full target information ADAMTS1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com