JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB104633

Recombinant Human AK6 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human AK6 protein is a Human Full Length protein, in the 1 to 172 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

CINAP, AD-004, CGI-137, AK6, Adenylate kinase isoenzyme 6, Adrenal gland protein AD-004, Coilin-interacting nuclear ATPase protein, Dual activity adenylate kinase/ATPase, hCINAP, AK/ATPase

1 Images
SDS-PAGE - Recombinant Human AK6 protein (AB104633)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human AK6 protein (AB104633)

15% SDS-PAGE showing ab104633 (3 μg) at approximately 22.2 kDa. (Molecular weight on SDS-PAGE will appear higher).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q9Y3D8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS","proteinLength":"Full Length","predictedMolecularWeight":"22.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":172,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9Y3D8","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

AK6 also known as adenylate kinase 6 is an enzyme that catalyzes the reversible transfer of phosphate groups from ATP to AMP producing two ADP molecules in the process. This enzyme weighs approximately 26 kDa. It is found within mitochondria and exhibits expression in numerous tissues including the heart and skeletal muscle. The protein plays a significant role in maintaining cellular energy homeostasis by regulating the adenylate energy charge of the cell.
Biological function summary

AK6 contributes to the cellular energy balance and is involved in nucleotide metabolism. It does not form part of large protein complexes acting instead through its enzymatic activity within individual cells. It modulates levels of ADP ATP and AMP which is important for processes that harness or require energy. By regulating these nucleotides AK6 influences muscle contraction cell proliferation and apoptosis.

Pathways

AK6 functions within the purine metabolism pathway and is an integral component of the energy metabolism pathway. It interacts with other adenylate kinases such as AK2 to manage the equilibrium of adenine nucleotides in cells. Its activity directly impacts the balance and flow of energy resources linking it to pathways that oversee energy transduction and cellular metabolic regulation.

Disruptions in AK6 activity affect energy metabolism potentially contributing to metabolic syndromes. Conditions such as mitochondrial myopathy and heart failure may display connections to irregular AK6 function. Also proteins like AK2 show interactions with AK6 during disease states indicating a possible pathway for therapeutic targets or diagnostic markers in energy-related conditions.

Specifications

Form

Liquid

Additional notes

ab104633 is purified using conventional chromatography techniques.

General info

Function

Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Has also ATPase activity (PubMed : 15630091). Involved in the late cytoplasmic maturation steps of the 40S ribosomal particles, specifically 18S rRNA maturation (PubMed : 27477389). While NMP activity is not required for ribosome maturation, ATPase activity is. Associates transiently with small ribosomal subunit protein uS11. ATP hydrolysis breaks the interaction with uS11. May temporarily remove uS11 from the ribosome to enable a conformational change of the ribosomal RNA that is needed for the final maturation step of the small ribosomal subunit (By similarity). Its NMP activity may have a role in nuclear energy homeostasis. AMP and dAMP are the preferred substrates, but CMP and dCMP are also good substrates. IMP is phosphorylated to a much lesser extent. All nucleoside triphosphates ATP, GTP, UTP, CTP, dATP, dCTP, dGTP, and TTP are accepted as phosphate donors. CTP is the best phosphate donor, followed by UTP, ATP, GTP and dCTP. May be involved in regulation of Cajal body (CB) formation (PubMed : 15630091).

Sequence similarities

Belongs to the adenylate kinase family. AK6 subfamily.

Subcellular localisation

Nucleus

Product protocols

Target data

Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Has also ATPase activity (PubMed : 15630091). Involved in the late cytoplasmic maturation steps of the 40S ribosomal particles, specifically 18S rRNA maturation (PubMed : 27477389). While NMP activity is not required for ribosome maturation, ATPase activity is. Associates transiently with small ribosomal subunit protein uS11. ATP hydrolysis breaks the interaction with uS11. May temporarily remove uS11 from the ribosome to enable a conformational change of the ribosomal RNA that is needed for the final maturation step of the small ribosomal subunit (By similarity). Its NMP activity may have a role in nuclear energy homeostasis. AMP and dAMP are the preferred substrates, but CMP and dCMP are also good substrates. IMP is phosphorylated to a much lesser extent. All nucleoside triphosphates ATP, GTP, UTP, CTP, dATP, dCTP, dGTP, and TTP are accepted as phosphate donors. CTP is the best phosphate donor, followed by UTP, ATP, GTP and dCTP. May be involved in regulation of Cajal body (CB) formation (PubMed : 15630091).
See full target information AK6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com