JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB93658

Recombinant Human ALIX protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ALIX protein (His tag N-Terminus) is a Human Fragment protein, in the 1 to 392 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

AIP1, ALIX, KIAA1375, PDCD6IP, Programmed cell death 6-interacting protein, PDCD6-interacting protein, ALG-2-interacting protein 1, ALG-2-interacting protein X, Hp95

1 Images
SDS-PAGE - Recombinant Human ALIX protein (His tag N-Terminus) (AB93658)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ALIX protein (His tag N-Terminus) (AB93658)

15% SDS-PAGE showing ab93658 at approximately 45.8kDa (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q8WUM4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLA","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":392,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q8WUM4","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ALIX also known as PDCD6IP or ALIX G is an adapter protein involved in various cellular processes. It holds a molecular weight of approximately 95-100 kDa and is widely expressed in different tissue types including HEK 293 cells. ALIX plays a significant role as a component of the endosomal sorting complexes required for transport (ESCRT) machinery contributing to membrane dynamics and intracellular trafficking.
Biological function summary

ALIX acts as an important mediator in the regulation of cellular membrane remodeling. It associates with several protein complexes influencing the budding and fission of vesicles and endosomes. The protein also interacts with ubiquitin and other factors guiding protein sorting and maintaining cellular homeostasis. This adapter characteristic makes ALIX essential for recycling receptors and maintaining cell surface receptor expression levels.

Pathways

ALIX is involved in the ESCRT pathway and the apoptotic pathways. It works closely with proteins like TSG101 and CHMP4 to facilitate vesicle formation and dispatch impacting cellular processes like signaling and waste disposal. Furthermore ALIX regulates apoptosis by interacting with proteins such as ALG-2 and to some extent with apoptosis-related membranes to mediate programmed cell death.

ALIX has established links to cancer progression and neurodegenerative disorders. Its participation in membrane remodeling and protein sorting correlates with tumor development with evidence showing that altered expression affects oncogenic pathways. Additionally dysregulation of ALIX-associated pathways has implications in neurodegenerative diseases where ALIX and proteins such as those in the ESCRT complex could play a role in the degradation of misfolded proteins and endocytic dysfunctions contributing to disease pathology.

Specifications

Form

Liquid

Additional notes

ab93658 is purified using conventional chromatography techniques.

General info

Function

Multifunctional protein involved in endocytosis, multivesicular body biogenesis, membrane repair, cytokinesis, apoptosis and maintenance of tight junction integrity. Class E VPS protein involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome. Binds to the phospholipid lysobisphosphatidic acid (LBPA) which is abundant in MVBs internal membranes. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complexes (PubMed : 14739459). The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis (PubMed : 17556548, PubMed : 17853893). Adapter for a subset of ESCRT-III proteins, such as CHMP4, to function at distinct membranes. Required for completion of cytokinesis (PubMed : 17556548, PubMed : 17853893, PubMed : 18641129). May play a role in the regulation of both apoptosis and cell proliferation. Regulates exosome biogenesis in concert with SDC1/4 and SDCBP (PubMed : 22660413). By interacting with F-actin, PARD3 and TJP1 secures the proper assembly and positioning of actomyosin-tight junction complex at the apical sides of adjacent epithelial cells that defines a spatial membrane domain essential for the maintenance of epithelial cell polarity and barrier (By similarity).. (Microbial infection) Involved in HIV-1 virus budding. Can replace TSG101 it its role of supporting HIV-1 release; this function requires the interaction with CHMP4B. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as enveloped virus budding (HIV-1 and other lentiviruses).

Post-translational modifications

May be phosphorylated on tyrosine residues by activated PDGFRB.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Multifunctional protein involved in endocytosis, multivesicular body biogenesis, membrane repair, cytokinesis, apoptosis and maintenance of tight junction integrity. Class E VPS protein involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome. Binds to the phospholipid lysobisphosphatidic acid (LBPA) which is abundant in MVBs internal membranes. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complexes (PubMed : 14739459). The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis (PubMed : 17556548, PubMed : 17853893). Adapter for a subset of ESCRT-III proteins, such as CHMP4, to function at distinct membranes. Required for completion of cytokinesis (PubMed : 17556548, PubMed : 17853893, PubMed : 18641129). May play a role in the regulation of both apoptosis and cell proliferation. Regulates exosome biogenesis in concert with SDC1/4 and SDCBP (PubMed : 22660413). By interacting with F-actin, PARD3 and TJP1 secures the proper assembly and positioning of actomyosin-tight junction complex at the apical sides of adjacent epithelial cells that defines a spatial membrane domain essential for the maintenance of epithelial cell polarity and barrier (By similarity).. (Microbial infection) Involved in HIV-1 virus budding. Can replace TSG101 it its role of supporting HIV-1 release; this function requires the interaction with CHMP4B. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as enveloped virus budding (HIV-1 and other lentiviruses).
See full target information PDCD6IP

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com