JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB268427

Recombinant Human alpha A Crystallin/CRYAA protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human alpha A Crystallin/CRYAA protein (His tag) is a Human Full Length protein, in the 1 to 173 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

CRYA1, HSPB4, CRYAA, Alpha-crystallin A chain, Heat shock protein beta-4, Heat shock protein family B member 4, HspB4

1 Images
SDS-PAGE - Recombinant Human alpha A Crystallin/CRYAA protein (His tag) (AB268427)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human alpha A Crystallin/CRYAA protein (His tag) (AB268427)

SDS-PAGE analysis of ab268427.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P02489

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7 Preservative: 1.02% Imidazole Constituents: 25% Glycerol (glycerin, glycerine), 1.74% Sodium chloride, 0.82% Sodium phosphate, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":173,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P02489","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Alpha A Crystallin also known as CRYAA or crystallin protein is a small heat shock protein with a molecular mass of approximately 20 kDa. It is the major structural protein in the eye lens and is also expressed in other tissues like the heart kidney and brain. The protein forms large complexes with other alpha crystallin proteins to provide structural stability and help maintain the transparency and refractive index of the lens. This specific role of alpha A Crystallin makes it essential for proper eye function.
Biological function summary

Alpha A Crystallin acts like a molecular chaperone. It helps prevent the aggregation of misfolded proteins which is important in maintaining cellular protein homeostasis. Alpha A Crystallin can combine with alpha B Crystallin in lens fiber cells to form a hetero-oligomeric complex. This ability to bind unfolded proteins and assist in refolding processes highlights its importance in cell stress responses especially in situations where proteins could potentially denature and lose function.

Pathways

Alpha A Crystallin participates significantly in the oxidative stress response and apoptotic pathways. It interacts with proteins involved in these processes such as caspases to inhibit cell death and curb the deleterious effects of reactive oxygen species. In the apoptotic pathway alpha A Crystallin's role in regulating cell survival highlights its association with proteins like Hsp70 another heat shock protein that serves as a stabilizing agent during cellular stress.

Certain mutations in alpha A Crystallin link it to cataracts and age-related macular degeneration. These ocular conditions arise when the protein's chaperone function declines leading to the aggregation of lens proteins and subsequent loss of lens transparency. Alpha B Crystallin the sister protein shows a similar role in these disorders indicating how disturbances in the intricate network of crystallin interactions affect ocular health.

Specifications

Form

Liquid

General info

Function

Contributes to the transparency and refractive index of the lens (PubMed : 18302245). In its oxidized form (absence of intramolecular disulfide bond), acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions (PubMed : 18199971, PubMed : 19595763, PubMed : 22120592, PubMed : 31792453). Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA (PubMed : 28935373).

Sequence similarities

Belongs to the small heat shock protein (HSP20) family.

Post-translational modifications

O-glycosylated; contains N-acetylglucosamine side chains.. Deamidation of Asn-101 in lens occurs mostly during the first 30 years of age, followed by a small additional amount of deamidation (approximately 5%) during the next approximately 38 years, resulting in a maximum of approximately 50% deamidation during the lifetime of the individual.. Phosphorylation on Ser-122 seems to be developmentally regulated. Absent in the first months of life, it appears during the first 12 years of human lifetime. The relative amount of phosphorylated form versus unphosphorylated form does not change over the lifetime of the individual.. Acetylation at Lys-70 may increase chaperone activity.. Undergoes age-dependent proteolytical cleavage at the C-terminus. Alpha-crystallin A(1-172) is the most predominant form produced most rapidly during the first 12 years of age and after this age is present in approximately 50% of the lens molecules.. In young individuals and during the first approximately 30 years of life, less than half molecules contain an intramolecular disulfide bond (oxidized form), while in the remaining fraction the cysteines are in the free sulfhydryl form (reduced form). With aging, the amount of oxidized form increases up to 90% and it becomes a major constituent of high molecular weight aggregates, concomitant with an age-dependent loss of its chaperone activity. The reduced form is undetectable in cataractous lenses.

Subcellular localisation

Nucleus

Product protocols

Target data

Contributes to the transparency and refractive index of the lens (PubMed : 18302245). In its oxidized form (absence of intramolecular disulfide bond), acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions (PubMed : 18199971, PubMed : 19595763, PubMed : 22120592, PubMed : 31792453). Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA (PubMed : 28935373).
See full target information CRYAA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com