JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152291

Recombinant Human alpha COP I/COPA protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human alpha COP I/COPA protein (GST tag N-Terminus) is a Human Fragment protein, in the 3 to 100 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Coatomer subunit alpha, Alpha-coat protein, HEP-COP, Alpha-COP, HEPCOP, COPA

1 Images
SDS-PAGE - Recombinant Human alpha COP I/COPA protein (GST tag N-Terminus) (AB152291)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human alpha COP I/COPA protein (GST tag N-Terminus) (AB152291)

12.5% SDS-PAGE showing ab152291 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

P53621

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as alpha COP I.

Sequence info

[{"sequence":"TKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTF","proteinLength":"Fragment","predictedMolecularWeight":"36.52 kDa","actualMolecularWeight":null,"aminoAcidEnd":100,"aminoAcidStart":3,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P53621","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Alpha COP I also called COPA protein or alpha COPS is a component of the COPI coatomer complex involved in intracellular transport. This protein weighs approximately 134 kDa. Alpha COP is mainly expressed in the Golgi apparatus and other intracellular organelles. It functions as part of the COPI complex which is essential for retrograde Golgi-to-ER transport of proteins and lipids. This complex also plays an important role in maintaining Golgi structure and functionality.
Biological function summary

The alpha COP participates in forming the cytosolic coatomer complex which contains seven different proteins. This complex is involved in the transport of vesicles within eukaryotic cells. Alpha COP helps in the recruitment and assembly of other coatomer subunits necessary for vesicle budding and cargo selection. The protein interacts with other vesicle-forming machinery components ensuring efficient segregation and transport of cargo molecules. Additionally COPA notes contribute to cell homeostasis through effectively gathering sets of transport proteins.

Pathways

Alpha COP influences the regulation of the secretory pathway and lipid biosynthesis. The coatomer proteins including alpha COP interact with Arf family proteins which are critical regulators of vesicle formation by promoting membrane curvature and binding cargo. Another pathway involving alpha COP is the endocytosis pathway which is important for the recycling of plasma membrane components. This pathway also connects alpha COP with other proteins related to clathrin-mediated vesicle trafficking.

Defects in alpha COP have links to hereditary disease known as COPA syndrome which manifests with autoimmune features and interstitial lung disease. Mutations in the COPA gene impair protein transport function leading to improper immune responses. Alpha COP's interaction with proteins in the autoimmunity pathways can further relate it to rheumatoid arthritis. It affects the immune system's regulatory mechanisms and shares interaction partners with other immune system proteins such as cytokines and transcription factors involved in inflammatory processes.

Specifications

Form

Liquid

General info

Function

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity).. Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor.

Product protocols

Target data

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity).. Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor.
See full target information Coatomer subunit alpha

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com