JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB173018

Recombinant Human alpha crystallin protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human alpha crystallin protein is a Human Full Length protein, in the 1 to 173 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

CRYA1, HSPB4, CRYAA, Alpha-crystallin A chain, Heat shock protein beta-4, Heat shock protein family B member 4, HspB4

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

HPLC, SDS-PAGE

applications

Biologically active

No

Accession

P02489

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 99% PBS, 0.06% EDTA

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS","proteinLength":"Full Length","predictedMolecularWeight":"20.97 kDa","actualMolecularWeight":null,"aminoAcidEnd":173,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P02489","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Alpha crystallin also known as CRYAA or CRYAB is a small heat shock protein with a mass approximately 20 kDa. This protein acts as a molecular chaperone and prevents aggregation of other proteins under stress conditions. Alpha crystallin is expressed predominantly in the lens of the eye but can also be found in the heart skeletal muscle and various other tissues. It exists as a heteropolymer composed of alpha A (CRYAA) and alpha B (CRYAB) subunits.
Biological function summary

Alpha crystallin maintains cellular homeostasis and protein integrity especially in the lens where it helps in maintaining transparency and refractive function. It does not form a fixed structure but rather an oligomeric complex capable of binding to partially unfolded proteins to prevent their aggregation a common feature of heat shock proteins. This protein also contributes to the survival of cells under conditions of stress assisting in cell architecture and integrity maintenance.

Pathways

This chaperone protein integrates into cellular stress response pathways where it prevents protein misfolding and aggregation. It associates with pathways such as the proteasome degradation pathway and the heat shock response. Alpha crystallin relates to other heat shock proteins like HSP27 which also work to protect cells from stress-induced damage by stabilizing the cytoskeleton and preventing apoptosis.

Mutations or altered expression of alpha crystallin have links to cataracts and cardiomyopathy. In cataracts the protein's ability to prevent lens protein aggregation becomes impaired leading to lens opacity. Alpha crystallin connections also extend to heat shock protein HSP70 in the context of cardiomyopathy where these proteins work together to protect cardiac cells from ischemic damage and apoptosis.

Specifications

Form

Liquid

Additional notes

ab173018 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution.

General info

Function

Contributes to the transparency and refractive index of the lens (PubMed : 18302245). In its oxidized form (absence of intramolecular disulfide bond), acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions (PubMed : 18199971, PubMed : 19595763, PubMed : 22120592, PubMed : 31792453). Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA (PubMed : 28935373).

Sequence similarities

Belongs to the small heat shock protein (HSP20) family.

Post-translational modifications

O-glycosylated; contains N-acetylglucosamine side chains.. Deamidation of Asn-101 in lens occurs mostly during the first 30 years of age, followed by a small additional amount of deamidation (approximately 5%) during the next approximately 38 years, resulting in a maximum of approximately 50% deamidation during the lifetime of the individual.. Phosphorylation on Ser-122 seems to be developmentally regulated. Absent in the first months of life, it appears during the first 12 years of human lifetime. The relative amount of phosphorylated form versus unphosphorylated form does not change over the lifetime of the individual.. Acetylation at Lys-70 may increase chaperone activity.. Undergoes age-dependent proteolytical cleavage at the C-terminus. Alpha-crystallin A(1-172) is the most predominant form produced most rapidly during the first 12 years of age and after this age is present in approximately 50% of the lens molecules.. In young individuals and during the first approximately 30 years of life, less than half molecules contain an intramolecular disulfide bond (oxidized form), while in the remaining fraction the cysteines are in the free sulfhydryl form (reduced form). With aging, the amount of oxidized form increases up to 90% and it becomes a major constituent of high molecular weight aggregates, concomitant with an age-dependent loss of its chaperone activity. The reduced form is undetectable in cataractous lenses.

Subcellular localisation

Nucleus

Product protocols

Target data

Contributes to the transparency and refractive index of the lens (PubMed : 18302245). In its oxidized form (absence of intramolecular disulfide bond), acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions (PubMed : 18199971, PubMed : 19595763, PubMed : 22120592, PubMed : 31792453). Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA (PubMed : 28935373).
See full target information CRYAA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com