JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB51189

Recombinant Human Alpha-synuclein protein (Tag Free)

Be the first to review this product! Submit a review

|

(12 Publications)

Recombinant Human Alpha-synuclein protein is a Human Full Length protein, in the 1 to 140 aa range with >95% purity, < 1 EU/µg endotoxin level and suitable for SDS-PAGE and western blot. The predicted molecular weight of ab51189 protein is 14.4 kDa.

- Save time and ensure accurate results - use our Alpha-synuclein (SNCA) protein as a control
- Available in different sizes to fit your experimental needs

View Alternative Names

NACP, PARK1, SNCA, Alpha-synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor

4 Images
Western blot - Recombinant Human Alpha-synuclein protein (Tag Free) (AB51189)
  • WB

Lab

Western blot - Recombinant Human Alpha-synuclein protein (Tag Free) (AB51189)

All lanes:

Western blot - Anti-Alpha-synuclein antibody [LB 509] (<a href='/en-us/products/primary-antibodies/alpha-synuclein-antibody-lb-509-ab27766'>ab27766</a>) at 5 µg/mL

Lane 1:

Western blot - Recombinant Human Alpha-synuclein protein (Tag Free) (ab51189) at 10 µg

Lane 2:

Human brain hippocampus tissue lysate - total protein (<a href='/en-us/products/unavailable/human-brain-hippocampus-tissue-lysate-total-protein-ab30180'>ab30180</a>) at 10 µg

Secondary

All lanes:

Goat polyclonal to Mouse IgG - H&L - Pre-Adsorbed (HRP) at 1/5000 dilution

Predicted band size: 14 kDa

Observed band size: 16 kDa,32 kDa

true

Exposure time: 20min

Western blot - Recombinant Human Alpha-synuclein protein (Tag Free) (AB51189)
  • WB

Unknown

Western blot - Recombinant Human Alpha-synuclein protein (Tag Free) (AB51189)

All lanes:

Western blot - Anti-Alpha-synuclein antibody [LB 509] (<a href='/en-us/products/primary-antibodies/alpha-synuclein-antibody-lb-509-ab27766'>ab27766</a>) at 1/1000 dilution

All lanes:

Western blot - Recombinant Human Alpha-synuclein protein (Tag Free) (ab51189) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Mouse IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-mouse-igg-h-l-hrp-preadsorbed-ab97040'>ab97040</a>) at 1/5000 dilution

Predicted band size: 14 kDa

true

Exposure time: 8min

Western blot - Recombinant Human Alpha-synuclein protein (Tag Free) (AB51189)
  • WB

Unknown

Western blot - Recombinant Human Alpha-synuclein protein (Tag Free) (AB51189)

All lanes:

Western blot - Anti-Alpha-synuclein antibody [LB 509] (<a href='/en-us/products/primary-antibodies/alpha-synuclein-antibody-lb-509-ab27766'>ab27766</a>) at 1/1000 dilution

All lanes:

Western blot - Recombinant Human Alpha-synuclein protein (Tag Free) (ab51189) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Mouse IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-mouse-igg-h-l-hrp-preadsorbed-ab97040'>ab97040</a>) at 5000 µg

Predicted band size: 14 kDa

true

Exposure time: 8min

SDS-PAGE - Recombinant Human Alpha-synuclein protein (Tag Free) (AB51189)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Alpha-synuclein protein (Tag Free) (AB51189)

ab51189 (3 μg) in 14% SDS-PAGE.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, WB

applications

Biologically active

No

Accession

P37840

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 0.58% Sodium chloride, 0.316% Tris HCl, 0.0095% Magnesium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab51189 can be used as a WB positive control in conjunction with <a href='/en-us/products/primary-antibodies/alpha-synuclein-antibody-lb-509-ab27766'>ab27766</a>.</p>" } } }

Product details

Ensure the validity of your result using our recombinant human Alpha-synuclein (SNCA) protein ab51189 as a positive control in western blot and SDS-PAGE.

The predicted molecular weight of ab51189 Alpha-synuclein (SNCA) protein is 14.4 kDa and the observed molecular weight on SDS-PAGE will appear higher.


Check out our protein gel staining guide for SDS-PAGE here

Check out of western blot protocol for more information here

Sequence info

[{"sequence":"MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA","proteinLength":"Full Length","predictedMolecularWeight":"14.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":140,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P37840","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Alpha-synuclein often referred to by alternate names such as SNCA is a protein of around 14 kDa mass. It mainly expresses in the brain particularly in presynaptic nerve terminals. This protein functions mechanically by stabilizing synaptic vesicles and maintaining synaptic function. It exists both in soluble monomer forms and as aggregates in protein filaments. Antibodies like 4D6 and EP1536Y target monomer forms of protein for more detailed studies.
Biological function summary

The alpha-synuclein protein plays critical roles in neuronal activity. It contributes to neurotransmitter release regulation by acting in the formation and plasticity of the presynaptic neuronal network. Alpha-synuclein doesn't usually form parts of large protein complexes but it may associate transiently with membranes and vesicular structures. The protein's monomer form has also been observed in alpha lines and related neuronal processes operating alongside various cellular functions.

Pathways

Synaptic vesicle trafficking and dopamine neurotransmitter release are significant areas involving the alpha-synuclein protein. In these pathways alpha-synuclein interacts with other proteins like synaptophysin and protein monomer monomerizations are intrinsic to these processes. Altered function or aggregation of alpha-synuclein disrupts these pathways influencing broader neurological functions.

Alterations or accumulations of alpha-synuclein are strongly linked to Parkinson's disease and Lewy body dementia. In these conditions alpha-synuclein forms abnormal protein filaments known as Lewy bodies within neurons. These formations disrupt cellular processes and neuron health. Synucleinopathies such as these show connections with proteins like parkin and DJ-1 which also have key roles in these neurodegenerative diseases.

Specifications

Form

Liquid

General info

Function

The protein expressed by the SNCA gene is involved in various synaptic activities, including the regulation of synaptic vesicle trafficking and neurotransmitter release. As a monomer, it enhances synaptic vesicle exocytosis through vesicle priming, fusion, and dilation of exocytotic fusion pores. Mechanistically, it increases local Ca(2+) release, which is crucial for ATP-induced exocytosis. In its multimeric membrane-bound form, SNCA acts as a molecular chaperone, assisting in the folding of synaptic fusion components known as SNAREs at the presynaptic plasma membrane, in conjunction with cysteine string protein-alpha/DNAJC5, a function that is vital for maintaining normal SNARE-complex assembly during aging. Additionally, SNCA plays a role in dopamine neurotransmission regulation by associating with the dopamine transporter (DAT1) and modulating its activity. This supplementary information is collated from multiple sources and compiled automatically.

Sequence similarities

Belongs to the synuclein family.

Post-translational modifications

Phosphorylated, predominantly on serine residues. Phosphorylation by CK1 appears to occur on residues distinct from the residue phosphorylated by other kinases. Phosphorylation of Ser-129 is selective and extensive in synucleinopathy lesions. In vitro, phosphorylation at Ser-129 promoted insoluble fibril formation. Phosphorylated on Tyr-125 by a PTK2B-dependent pathway upon osmotic stress.. Hallmark lesions of neurodegenerative synucleinopathies contain alpha-synuclein that is modified by nitration of tyrosine residues and possibly by dityrosine cross-linking to generated stable oligomers.. Ubiquitinated. The predominant conjugate is the diubiquitinated form.. Acetylation at Met-1 seems to be important for proper folding and native oligomeric structure.

Product protocols

Target data

The protein expressed by the SNCA gene is involved in various synaptic activities, including the regulation of synaptic vesicle trafficking and neurotransmitter release. As a monomer, it enhances synaptic vesicle exocytosis through vesicle priming, fusion, and dilation of exocytotic fusion pores. Mechanistically, it increases local Ca(2+) release, which is crucial for ATP-induced exocytosis. In its multimeric membrane-bound form, SNCA acts as a molecular chaperone, assisting in the folding of synaptic fusion components known as SNAREs at the presynaptic plasma membrane, in conjunction with cysteine string protein-alpha/DNAJC5, a function that is vital for maintaining normal SNARE-complex assembly during aging. Additionally, SNCA plays a role in dopamine neurotransmission regulation by associating with the dopamine transporter (DAT1) and modulating its activity. This supplementary information is collated from multiple sources and compiled automatically.
See full target information SNCA

Publications (12)

Recent publications for all applications. Explore the full list and refine your search

International journal of molecular sciences 25: PubMed39684444

2024

Malvidin-3-O-Glucoside Mitigates α-Syn and MPTP Co-Induced Oxidative Stress and Apoptosis in Human Microglial HMC3 Cells.

Applications

Unspecified application

Species

Unspecified reactive species

Rachit Sood, Sanjay,Sung-Ung Kang,Na Young Yoon,Hae-Jeung Lee

ACS chemical neuroscience 15:2623-2632 PubMed38959406

2024

Mechanistic Insight into Intestinal α-Synuclein Aggregation in Parkinson's Disease Using a Laser-Printed Electrochemical Sensor.

Applications

Unspecified application

Species

Unspecified reactive species

Julia M Balsamo,Keren Zhou,Vinay Kammarchedu,Aida Ebrahimi,Elizabeth N Bess

ACS chemical biology 19:1011-1021 PubMed38517270

2024

Discovery of a Gut Bacterial Metabolic Pathway that Drives α-Synuclein Aggregation.

Applications

Unspecified application

Species

Unspecified reactive species

Lizett Ortiz de Ora,Julia M Balsamo,Kylie S Uyeda,Elizabeth N Bess

Acta pharmacologica Sinica 45:66-75 PubMed37605049

2023

Pharmacological inhibition of FABP7 by MF 6 counteracts cerebellum dysfunction in an experimental multiple system atrophy mouse model.

Applications

Unspecified application

Species

Unspecified reactive species

An Cheng,Wenbin Jia,David I Finkelstein,Nadia Stefanova,Haoyang Wang,Takuya Sasaki,Ichiro Kawahata,Kohji Fukunaga

Molecular neurodegeneration 18:29 PubMed37131250

2023

Mutations in α-synuclein, TDP-43 and tau prolong protein half-life through diminished degradation by lysosomal proteases.

Applications

Unspecified application

Species

Unspecified reactive species

Paul J Sampognaro,Shruti Arya,Giselle M Knudsen,Emma L Gunderson,Angelica Sandoval-Perez,Molly Hodul,Kathryn Bowles,Charles S Craik,Matthew P Jacobson,Aimee W Kao

ACS measurement science au 2:485-492 PubMed36785659

2022

Development of a 36-Channel Instrument for Assaying Biomarkers of Ultralow Concentrations Utilizing Immunomagnetic Reduction.

Applications

Unspecified application

Species

Unspecified reactive species

Hsin-Hsien Chen,Ming-Hung Hsu,Kun-Hung Lee,Shieh-Yueh Yang

Frontiers in neurology 10:1388 PubMed32038461

2020

Plasma and Serum Alpha-Synuclein as a Biomarker of Diagnosis in Patients With Parkinson's Disease.

Applications

Unspecified application

Species

Unspecified reactive species

Chun-Wei Chang,Shieh-Yueh Yang,Che-Chuan Yang,Chia-Wen Chang,Yih-Ru Wu

Journal of molecular medicine (Berlin, Germany) 97:1329-1344 PubMed31302715

2019

Exosomes from patients with Parkinson's disease are pathological in mice.

Applications

Unspecified application

Species

Unspecified reactive species

Chao Han,Nian Xiong,Xingfang Guo,Jinsha Huang,Kai Ma,Ling Liu,Yun Xia,Yan Shen,Jie Li,Haiyang Jiang,Luxi Wang,Shiyi Guo,Xiaoyun Xu,Guoxin Zhang,Jingyu Liu,Xuebing Cao,Zhentao Zhang,Zhicheng Lin,Tao Wang

Scientific reports 7:7506 PubMed28790319

2017

Novel animal model defines genetic contributions for neuron-to-neuron transfer of α-synuclein.

Applications

Unspecified application

Species

Unspecified reactive species

Trevor Tyson,Megan Senchuk,Jason F Cooper,Sonia George,Jeremy M Van Raamsdonk,Patrik Brundin

Molecular neurodegeneration 12:44 PubMed28592329

2017

Autoimmune antibody decline in Parkinson's disease and Multiple System Atrophy; a step towards immunotherapeutic strategies.

Applications

Unspecified application

Species

Unspecified reactive species

Tomasz Brudek,Kristian Winge,Jonas Folke,Søren Christensen,Karina Fog,Bente Pakkenberg,Lars Østergaard Pedersen
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com