JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB218819

Recombinant Human Alpha-synuclein protein aggregate (Active)

Be the first to review this product! Submit a review

|

(14 Publications)

Recombinant Human Alpha-synuclein protein aggregate (Active) is a Human Full Length SNCA protein, in the 1 to 140 aa range with >95% purity, <= 20 EU/mL endotoxin level and suitable for western blot, Functional studies and SDS-PAGE. The predicted molecular weight of ab218819 recombinant protein is 14.5 kDa.

- Suitable for Thioflavin T Fluorescence assay
- Save time and ensure accurate results - use recombinant Alpha-synuclein (SNCA) protein
- Optimal protein bioactivity, stability and reproducibility

View Alternative Names

NACP, PARK1, SNCA, Alpha-synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor

8 Images
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)
  • IHC-P

Supplier Data

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)

Immunohistochemical analysis of primary rat hippocampal neurons showing lewy body inclusion formation when treated with active Alpha Synuclein Protein Aggregate (ab218819) at 4 μg/ml (D-F), but not when treated with control Alpha Synuclein Protein Aggregate (ab218817) at 4 μg/ml (A-C). Tissue : Primary hippocampal neurons. Species : Sprague-Dawley rat. Fixation : 4% formaldehyde from PFA. Primary antibody : Mouse anti-pSer129 Antibody at 1/1000 24 hours at 4°C. Secondary antibody : FITC Goat Anti-Mouse (green) at 1/700 for 1 hour at RT. Counterstain : Hoechst (blue) nuclear stain at 1/4000 for 1 hour at RT. Localization : Lewy body incluscions. Magnification : 20x.

Immunocytochemistry/ Immunofluorescence - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)
  • ICC/IF

Supplier Data

Immunocytochemistry/ Immunofluorescence - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)

ab218819 was shown to be taken up by SH-SY5Y cells and transmitted to neuronal iPSCs within 14 days. Blue : Hoechst/DNA; Green : SHSY5Y-GFP; Red : Alpha-synuclein protein aggregate (ab218819); Purple : Tubulin.

Electron Microscopy - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)
  • EM

Supplier Data

Electron Microscopy - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)

TEM of active human alpha synuclein preformed fibrils (ab218819) (top) and control (inactive) human alpha synuclein preformed fibrils (ab218817) (bottom). Fibrils were sonicated and treated with uranyl acetate. The active fibrils are shorter than the inactive fibrils.

Functional Studies - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)

ab218819 seeds the formation of new alpha synuclein fibrils from the pool of alpha synuclein monomers.

Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in alpha synuclein fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift, and increased fluorescence intensity.

Thioflavin T emission curves show increased fluorescence (correlated to alpha synuclein protein aggregation) over time when 10 μM of ab218819 is combined with 100 μM of alpha synuclein monomer, as compared to ab218819 alone and alpha synuclein monomer alone.

Thioflavin T ex = 450 nm, em = 485 nm.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)
  • IHC-P

Supplier Data

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)

Immunohistochemistry analysis of rat brain injected with active human alpha synuclein PFFs (ab218819). Species : Female Sprague-Dawley Rat. Rat was injected with 2μL active human alpha synuclein PFFs (ab218819) in each of 2 injection sites : AP+1.6, ML+2.4, DV-4.2 from skull; and AP-1.4, ML+0.2, DV-2.8 from skull. 30-days post-injection. Fixation : Saline perfusion followed by 4% PFA fixation for 48 hrs. Secondary Antibody : Biotin-SP Donkey Anti-Rabbit IgG (H+L) at 1 : 500 for 2 hours in cold room with shaking. ABC signal amplification, DAB staining. Alpha synuclein pathology is seen in the striatum close to an injection site.

Electron Microscopy - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)
  • EM

Supplier Data

Electron Microscopy - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)

TEM of Type 1 Alpha Synuclein Pre-formed Fibrils (PFFs) (ab218819)

Immunocytochemistry/ Immunofluorescence - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)
  • ICC/IF

Supplier Data

Immunocytochemistry/ Immunofluorescence - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)

Immunocytochemistry/Immunofluorescence analysis of human iPSC-derived neurons treated with alpha synuclein pre-formed fibrils (ab218819). Primary Antibody : Mouse Anti-Alpha Synuclein (pSer129) Monoclonal Antibody at 1 : 1000 for O/N at 4°C. Secondary Antibody : Anti-Rabbit : A488 at 1 : 1000 for 1 hour at RT. Magnification : 40X. Nuclear stain : Hoechst- 20 min, RT (blue). Actin stain : Phalloidin-647- 20 min, RT (magenta). 4K cells per well. Negative control; no fibrils added to well. B) 7 days after addition of active recombinant human pre-formed fibrils (Type 1). Fibrils were sonicated before use and applied 2.5 ug per well

SDS-PAGE - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Alpha-synuclein protein aggregate (Active) (AB218819)

SDS-PAGE analysis of ab218819.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<20 EU/mL

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS, SDS-PAGE, EM

applications

Biologically active

Yes

Biological activity

Endogenous alpha-synuclein phosphorylation.

100 μM alpha synuclein protein monomer (ab218818) seeded with 10 μM alpha synuclein protein aggregate (ab218819) in 25 μM Thioflavin T (ab120751) (PBS pH 7.4, 100 μl reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours.

Fluorescence was measured by excitation at 450 nm and emission at 485 nm on a microplate reader.

Endotoxin Level: 10-20 EU/mL

Accession

P37840

Animal free

No

Carrier free

No

Species

Human

Storage buffer

Constituents: 95% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "EM": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

You may be interested in:

AB260052

Human Alpha-synuclein ELISA Kit

5

2 Reviews

View product

We recommend this product because it’s often used in the same experiment or related research.

We advise that you always check the datasheet to ensure it fits your experiments, or contact ourtechnical teamfor help.

Product details

Ensure the validity of your result using our Recombinant Alpha-synuclein (SNCA) protein ab90285 as a control.
ab218819 can be used as a positive control in SDS-PAGE and western blot assays.

Check out our Thioflavin T assay protocol here.

For best results, sonicate ab218819 immediately prior to use. Sonication of PFFs is required in order to obtain fibrils with an average length of ~50nm, the optimal size for pathology.

Sequence info

[{"sequence":"MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA","proteinLength":"Full Length","predictedMolecularWeight":"14.46 kDa","actualMolecularWeight":null,"aminoAcidEnd":140,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P37840","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Alpha-synuclein often referred to by alternate names such as SNCA is a protein of around 14 kDa mass. It mainly expresses in the brain particularly in presynaptic nerve terminals. This protein functions mechanically by stabilizing synaptic vesicles and maintaining synaptic function. It exists both in soluble monomer forms and as aggregates in protein filaments. Antibodies like 4D6 and EP1536Y target monomer forms of protein for more detailed studies.
Biological function summary

The alpha-synuclein protein plays critical roles in neuronal activity. It contributes to neurotransmitter release regulation by acting in the formation and plasticity of the presynaptic neuronal network. Alpha-synuclein doesn't usually form parts of large protein complexes but it may associate transiently with membranes and vesicular structures. The protein's monomer form has also been observed in alpha lines and related neuronal processes operating alongside various cellular functions.

Pathways

Synaptic vesicle trafficking and dopamine neurotransmitter release are significant areas involving the alpha-synuclein protein. In these pathways alpha-synuclein interacts with other proteins like synaptophysin and protein monomer monomerizations are intrinsic to these processes. Altered function or aggregation of alpha-synuclein disrupts these pathways influencing broader neurological functions.

Alterations or accumulations of alpha-synuclein are strongly linked to Parkinson's disease and Lewy body dementia. In these conditions alpha-synuclein forms abnormal protein filaments known as Lewy bodies within neurons. These formations disrupt cellular processes and neuron health. Synucleinopathies such as these show connections with proteins like parkin and DJ-1 which also have key roles in these neurodegenerative diseases.

Specifications

Form

Liquid

Additional notes

ab218819 was purified by ion-exchange.

General info

Function

The protein expressed by the SNCA gene is involved in various synaptic activities, including the regulation of synaptic vesicle trafficking and neurotransmitter release. As a monomer, it enhances synaptic vesicle exocytosis through vesicle priming, fusion, and dilation of exocytotic fusion pores. Mechanistically, it increases local Ca(2+) release, which is crucial for ATP-induced exocytosis. In its multimeric membrane-bound form, SNCA acts as a molecular chaperone, assisting in the folding of synaptic fusion components known as SNAREs at the presynaptic plasma membrane, in conjunction with cysteine string protein-alpha/DNAJC5, a function that is vital for maintaining normal SNARE-complex assembly during aging. Additionally, SNCA plays a role in dopamine neurotransmission regulation by associating with the dopamine transporter (DAT1) and modulating its activity. This supplementary information is collated from multiple sources and compiled automatically.

Sequence similarities

Belongs to the synuclein family.

Post-translational modifications

Phosphorylated, predominantly on serine residues. Phosphorylation by CK1 appears to occur on residues distinct from the residue phosphorylated by other kinases. Phosphorylation of Ser-129 is selective and extensive in synucleinopathy lesions. In vitro, phosphorylation at Ser-129 promoted insoluble fibril formation. Phosphorylated on Tyr-125 by a PTK2B-dependent pathway upon osmotic stress.. Hallmark lesions of neurodegenerative synucleinopathies contain alpha-synuclein that is modified by nitration of tyrosine residues and possibly by dityrosine cross-linking to generated stable oligomers.. Ubiquitinated. The predominant conjugate is the diubiquitinated form.. Acetylation at Met-1 seems to be important for proper folding and native oligomeric structure.

Product protocols

For this product, it's our understanding that no specific protocols are required. You can visit:

Target data

The protein expressed by the SNCA gene is involved in various synaptic activities, including the regulation of synaptic vesicle trafficking and neurotransmitter release. As a monomer, it enhances synaptic vesicle exocytosis through vesicle priming, fusion, and dilation of exocytotic fusion pores. Mechanistically, it increases local Ca(2+) release, which is crucial for ATP-induced exocytosis. In its multimeric membrane-bound form, SNCA acts as a molecular chaperone, assisting in the folding of synaptic fusion components known as SNAREs at the presynaptic plasma membrane, in conjunction with cysteine string protein-alpha/DNAJC5, a function that is vital for maintaining normal SNARE-complex assembly during aging. Additionally, SNCA plays a role in dopamine neurotransmission regulation by associating with the dopamine transporter (DAT1) and modulating its activity. This supplementary information is collated from multiple sources and compiled automatically.
See full target information SNCA

Publications (14)

Recent publications for all applications. Explore the full list and refine your search

Neurotherapeutics : the journal of the American Society for Experimental NeuroTherapeutics 22:e00538 PubMed39904669

2025

Fibrinogen degradation products exacerbate alpha-synuclein aggregation by inhibiting autophagy via downregulation of Beclin1 in multiple system atrophy.

Applications

Unspecified application

Species

Unspecified reactive species

Huanzhu Liu,Ruoyang Yu,Muwei Zhang,Xiaoyan Zheng,Lizi Zhong,Wanlin Yang,Yuqi Luo,Zifeng Huang,Jialing Zheng,Hui Zhong,Xiaobo Wei,Wenhua Zheng,Yinghua Yu,Qing Wang

Military Medical Research 11:48 PubMed39034405

2024

TGF-β1 mediates hypoxia-preconditioned olfactory mucosa mesenchymal stem cells improved neural functional recovery in Parkinson's disease models and patients.

Applications

Unspecified application

Species

Unspecified reactive species

Yi Zhuo,Wen-Shui Li,Wen Lu,Xuan Li,Li-Te Ge,Yan Huang,Qing-Tao Gao,Yu-Jia Deng,Xin-Chen Jiang,Zi-Wei Lan,Que Deng,Yong-Heng Chen,Yi Xiao,Shuo Lu,Feng Jiang,Zuo Liu,Li Hu,Yu Liu,Yu Ding,Zheng-Wen He,De-An Tan,Da Duan,Ming Lu

Life science alliance 7: PubMed38609183

2024

Nr1h4 and Thrb ameliorate ER stress and provide protection in the MPTP mouse model of Parkinson's.

Applications

Unspecified application

Species

Unspecified reactive species

Nancy Ahuja,Shalini Gupta,Rashmi Arora,Ella Bhagyaraj,Drishti Tiwari,Sumit Kumar,Pawan Gupta

Journal of neuroinflammation 21:81 PubMed38566081

2024

Metformin normalizes mitochondrial function to delay astrocyte senescence in a mouse model of Parkinson's disease through Mfn2-cGAS signaling.

Applications

Unspecified application

Species

Unspecified reactive species

Min Wang,Tian Tian,Hong Zhou,Si-Yuan Jiang,Ying-Ying Jiao,Zhu Zhu,Jiang Xia,Jian-Hua Ma,Ren-Hong Du

Advanced materials (Deerfield Beach, Fla.) 35:e2304654 PubMed37753928

2023

Brain-Targeted Liposomes Loaded with Monoclonal Antibodies Reduce Alpha-Synuclein Aggregation and Improve Behavioral Symptoms in Parkinson's Disease.

Applications

Unspecified application

Species

Unspecified reactive species

Mor Sela,Maria Poley,Patricia Mora-Raimundo,Shaked Kagan,Aviram Avital,Maya Kaduri,Gal Chen,Omer Adir,Adi Rozencweig,Yfat Weiss,Ofir Sade,Yael Leichtmann-Bardoogo,Lilach Simchi,Shlomit Aga-Mizrachi,Batia Bell,Yoel Yeretz-Peretz,Aviv Zaid Or,Ashwani Choudhary,Idan Rosh,Diogo Cordeiro,Stav Cohen-Adiv,Yevgeny Berdichevsky,Anas Odeh,Jeny Shklover,Janna Shainsky-Roitman,Joshua E Schroeder,Dov Hershkovitz,Peleg Hasson,Avraham Ashkenazi,Shani Stern,Tal Laviv,Ayal Ben-Zvi,Avi Avital,Uri Ashery,Ben M Maoz,Avi Schroeder

Cell death and differentiation 30:2280-2292 PubMed37633968

2023

The cGAS-STING-YY1 axis accelerates progression of neurodegeneration in a mouse model of Parkinson's disease via LCN2-dependent astrocyte senescence.

Applications

Unspecified application

Species

Unspecified reactive species

Si-Yuan Jiang,Tian Tian,Hang Yao,Xiao-Mei Xia,Cong Wang,Lei Cao,Gang Hu,Ren-Hong Du,Ming Lu

Cells 12: PubMed37174736

2023

The Pesticide Chlordecone Promotes Parkinsonism-like Neurodegeneration with Tau Lesions in Midbrain Cultures and Worms.

Applications

Unspecified application

Species

Unspecified reactive species

Valeria Parrales-Macias,Patrick P Michel,Aurore Tourville,Rita Raisman-Vozari,Stéphane Haïk,Stéphane Hunot,Nicolas Bizat,Annie Lannuzel

Cells 11: PubMed36497031

2022

UBA52 Is Crucial in HSP90 Ubiquitylation and Neurodegenerative Signaling during Early Phase of Parkinson's Disease.

Applications

Unspecified application

Species

Unspecified reactive species

Shubhangini Tiwari,Abhishek Singh,Parul Gupta,Sarika Singh

Frontiers in immunology 13:833515 PubMed35309340

2022

Celastrol Downmodulates Alpha-Synuclein-Specific T Cell Responses by Mediating Antigen Trafficking in Dendritic Cells.

Applications

Unspecified application

Species

Unspecified reactive species

Lam Ng,Xiaohui Wang,Chuanbin Yang,Chengfu Su,Min Li,Allen Ka Loon Cheung

Biomolecules 12: PubMed35204664

2022

Spreading of Aggregated α-Synuclein in Sagittal Organotypic Mouse Brain Slices.

Applications

Unspecified application

Species

Unspecified reactive species

Buket Uçar,Nadia Stefanova,Christian Humpel
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Associated Products

Select an associated product type
Alternative Product
Proteins & Peptides

AB218817

Recombinant Human Alpha-synuclein protein aggregate (Type 2)

proteins-peptides

recombinant-human-alpha-synuclein-protein-aggregate-type-2-ab218817

0

(0 reviews)

Alternative Product
Proteins & Peptides

AB218818

Recombinant Human Alpha-synuclein protein monomer (Active)

proteins-peptides

recombinant-human-alpha-synuclein-protein-monomer-active-ab218818

0

(0 reviews)

Alternative Product
Proteins & Peptides

AB246002

Recombinant mouse Alpha-synuclein protein aggregate Type 1 (Active)

proteins-peptides

recombinant-mouse-alpha-synuclein-protein-aggregate-type-1-active-ab246002

0

(0 reviews)

Alternative Product
Proteins & Peptides

AB226434

Recombinant Rat Alpha-synuclein protein (Tagged)

proteins-peptides

recombinant-rat-alpha-synuclein-protein-tagged-ab226434

0

(0 reviews)

Alternative Product
Proteins & Peptides

AB17041

Human Alpha-synuclein peptide

proteins-peptides

human-alpha-synuclein-peptide-ab17041

0

(0 reviews)

Alternative Product
Proteins & Peptides

AB254309

Recombinant human Alpha-Synuclein protein filament

proteins-peptides

recombinant-human-alpha-synuclein-protein-filament-ab254309

0

(0 reviews)

Alternative Product
Proteins & Peptides

AB254310

Recombinant human Alpha-Synuclein protein monomer

proteins-peptides

recombinant-human-alpha-synuclein-protein-monomer-ab254310

0

(0 reviews)

Alternative Product
Proteins & Peptides

AB51188

Recombinant Human Alpha-synuclein (mutated E46K) protein

proteins-peptides

recombinant-human-alpha-synuclein-mutated-e46k-protein-ab51188

0

(0 reviews)

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com