JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB218817

Recombinant Human Alpha-synuclein protein aggregate (Type 2)

Be the first to review this product! Submit a review

|

(3 Publications)

Recombinant Human Alpha-synuclein protein aggregate (Type 2) is a Human Full Length protein, in the 1 to 140 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

NACP, PARK1, SNCA, Alpha-synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor

3 Images
Functional Studies - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (AB218817)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (AB218817)

TEM of ab218817.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (AB218817)
  • IHC-P

Supplier Data

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (AB218817)

Immunohistochemical analysis of 4% formaldehyde fixed primary rat hippocampal neurons from Sprague-Dawley rat labeling lewy body inclusions formed when treated with active Alpha Synuclein Protein Aggregate at 4 μg/ml (D-F), but not when treated with ab218817 at 4 μg/ml (A-C).

Primary antibody : Mouse anti-pSer129 antibody at 1/1000 24 hours at 4°C. Secondary antibody : FITC Goat Anti-Mouse (green) at 1/700 for 1 hours at RT. Counterstain : Hoechst (blue) nuclear stain at 1/4000 for 1 hour at RT. Magnification : 20x.

SDS-PAGE - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (AB218817)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Alpha-synuclein protein aggregate (Type 2) (AB218817)

SDS-PAGE analysis of ab218817.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

No

Accession

P37840

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>For best results, sonicate immediately prior to use.</p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>For best results, sonicate immediately prior to use.</p>" } } }

Product details

ab218817 is a protein aggregate which can be used as a control in various assays.

Learn more.

Sequence info

[{"sequence":"MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA","proteinLength":"Full Length","predictedMolecularWeight":"14 kDa","actualMolecularWeight":null,"aminoAcidEnd":140,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P37840","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Alpha-synuclein often referred to by alternate names such as SNCA is a protein of around 14 kDa mass. It mainly expresses in the brain particularly in presynaptic nerve terminals. This protein functions mechanically by stabilizing synaptic vesicles and maintaining synaptic function. It exists both in soluble monomer forms and as aggregates in protein filaments. Antibodies like 4D6 and EP1536Y target monomer forms of protein for more detailed studies.
Biological function summary

The alpha-synuclein protein plays critical roles in neuronal activity. It contributes to neurotransmitter release regulation by acting in the formation and plasticity of the presynaptic neuronal network. Alpha-synuclein doesn't usually form parts of large protein complexes but it may associate transiently with membranes and vesicular structures. The protein's monomer form has also been observed in alpha lines and related neuronal processes operating alongside various cellular functions.

Pathways

Synaptic vesicle trafficking and dopamine neurotransmitter release are significant areas involving the alpha-synuclein protein. In these pathways alpha-synuclein interacts with other proteins like synaptophysin and protein monomer monomerizations are intrinsic to these processes. Altered function or aggregation of alpha-synuclein disrupts these pathways influencing broader neurological functions.

Alterations or accumulations of alpha-synuclein are strongly linked to Parkinson's disease and Lewy body dementia. In these conditions alpha-synuclein forms abnormal protein filaments known as Lewy bodies within neurons. These formations disrupt cellular processes and neuron health. Synucleinopathies such as these show connections with proteins like parkin and DJ-1 which also have key roles in these neurodegenerative diseases.

Specifications

Form

Liquid

Additional notes

ab218817 is purified by ion-exchange and 0.2µm filtered.

General info

Function

The protein expressed by the SNCA gene is involved in various synaptic activities, including the regulation of synaptic vesicle trafficking and neurotransmitter release. As a monomer, it enhances synaptic vesicle exocytosis through vesicle priming, fusion, and dilation of exocytotic fusion pores. Mechanistically, it increases local Ca(2+) release, which is crucial for ATP-induced exocytosis. In its multimeric membrane-bound form, SNCA acts as a molecular chaperone, assisting in the folding of synaptic fusion components known as SNAREs at the presynaptic plasma membrane, in conjunction with cysteine string protein-alpha/DNAJC5, a function that is vital for maintaining normal SNARE-complex assembly during aging. Additionally, SNCA plays a role in dopamine neurotransmission regulation by associating with the dopamine transporter (DAT1) and modulating its activity. This supplementary information is collated from multiple sources and compiled automatically.

Sequence similarities

Belongs to the synuclein family.

Post-translational modifications

Phosphorylated, predominantly on serine residues. Phosphorylation by CK1 appears to occur on residues distinct from the residue phosphorylated by other kinases. Phosphorylation of Ser-129 is selective and extensive in synucleinopathy lesions. In vitro, phosphorylation at Ser-129 promoted insoluble fibril formation. Phosphorylated on Tyr-125 by a PTK2B-dependent pathway upon osmotic stress.. Hallmark lesions of neurodegenerative synucleinopathies contain alpha-synuclein that is modified by nitration of tyrosine residues and possibly by dityrosine cross-linking to generated stable oligomers.. Ubiquitinated. The predominant conjugate is the diubiquitinated form.. Acetylation at Met-1 seems to be important for proper folding and native oligomeric structure.

Product protocols

Target data

The protein expressed by the SNCA gene is involved in various synaptic activities, including the regulation of synaptic vesicle trafficking and neurotransmitter release. As a monomer, it enhances synaptic vesicle exocytosis through vesicle priming, fusion, and dilation of exocytotic fusion pores. Mechanistically, it increases local Ca(2+) release, which is crucial for ATP-induced exocytosis. In its multimeric membrane-bound form, SNCA acts as a molecular chaperone, assisting in the folding of synaptic fusion components known as SNAREs at the presynaptic plasma membrane, in conjunction with cysteine string protein-alpha/DNAJC5, a function that is vital for maintaining normal SNARE-complex assembly during aging. Additionally, SNCA plays a role in dopamine neurotransmission regulation by associating with the dopamine transporter (DAT1) and modulating its activity. This supplementary information is collated from multiple sources and compiled automatically.
See full target information SNCA

Publications (3)

Recent publications for all applications. Explore the full list and refine your search

ACS chemical neuroscience 15:2623-2632 PubMed38959406

2024

Mechanistic Insight into Intestinal α-Synuclein Aggregation in Parkinson's Disease Using a Laser-Printed Electrochemical Sensor.

Applications

Unspecified application

Species

Unspecified reactive species

Julia M Balsamo,Keren Zhou,Vinay Kammarchedu,Aida Ebrahimi,Elizabeth N Bess

ACS chemical biology 19:1011-1021 PubMed38517270

2024

Discovery of a Gut Bacterial Metabolic Pathway that Drives α-Synuclein Aggregation.

Applications

Unspecified application

Species

Unspecified reactive species

Lizett Ortiz de Ora,Julia M Balsamo,Kylie S Uyeda,Elizabeth N Bess

Biomolecules 12: PubMed35204664

2022

Spreading of Aggregated α-Synuclein in Sagittal Organotypic Mouse Brain Slices.

Applications

Unspecified application

Species

Unspecified reactive species

Buket Uçar,Nadia Stefanova,Christian Humpel
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com