JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB254309

Recombinant human Alpha-Synuclein protein filament

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Alpha-Synuclein protein filament is a Human Full Length protein, in the 1 to 140 aa range with >95% purity, < 0.1 EU/µg endotoxin level and suitable for SDS-PAGE, Functional studies, ELISA and Dot blot. The predicted molecular weight of ab254309 protein is 14.5 kDa.

- Suitable for Thioflavin T Fluorescence assay
- Save time and ensure accurate results - use our human Alpha-synuclein (SNCA) protein as a control
- Optimal protein bioactivity and stability

View Alternative Names

NACP, PARK1, SNCA, Alpha-synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor

4 Images
Sandwich ELISA - Recombinant human Alpha-Synuclein protein filament (AB254309)
  • sELISA

Lab

Sandwich ELISA - Recombinant human Alpha-Synuclein protein filament (AB254309)

Sandwich ELISA - Recombinant human Alpha-Synuclein protein filament standard curve

Background subtracted standard curve using Human Alpha-synuclein Antibody Pair - BSA and Azide free (ab270346) and Recombinant human Alpha-Synuclein protein filament (ab254309) in sandwich ELISA. The ELISA was performed using the components of the corresponding SimpleStep® kit, which uses the same antibody pair with a different formulation and format.

Functional Studies - Recombinant human Alpha-Synuclein protein filament (AB254309)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Alpha-Synuclein protein filament (AB254309)

Thioflavin binding by ab254309.

Functional in a thioflavin binding assay.

>x100 signal when compared to monomer control.

SDS-PAGE - Recombinant human Alpha-Synuclein protein filament (AB254309)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Alpha-Synuclein protein filament (AB254309)

SDS-PAGE analysis of ab254309.

Dot Blot - Recombinant human Alpha-Synuclein protein filament (AB254309)
  • Dot

Supplier Data

Dot Blot - Recombinant human Alpha-Synuclein protein filament (AB254309)

Confirmation specific Antibody binding.

Positive signal when assayed by Dotblot, binding ab209538.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS, Dot, sELISA

applications

Biologically active

Yes

Biological activity

Functional in a thioflavin binding assay.

>x100 signal when compared to monomer control.

Accession

P37840

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in water

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Dot": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "sELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our bioactive recombinant human Alpha-synuclein protein filament ab254309 as a control in SDS-PAGE and Dot blot assays.

Analyze your alpha-synuclein (SNCA) ELISA data using the ab254309 protein to generate and plot a standard curve.


Check out our protein gel staining guide for SDS-PAGE here

Check out our western blot protocol for more information here


Protocol FAQ

Q: Do you have a recommended protocol for the Thioflavin T Fluorescence assay?

A: Please check our recommended Thioflavin T Fluorescence assay here


Function

Alpha-Synuclein is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals. The deposition of the abundant presynaptic brain protein alpha-synuclein as fibrillary aggregates in neurons or glial cells is a hallmark lesion in a subset of neurodegenerative disorders. These disorders include Parkinson's disease (PD), dementia with Lewy bodies (DLB) and multiple system atrophy, collectively referred to as synucleinopathies. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin.

Collaborations
This antibody was developed with support from The Michael J. Fox Foundation.

Sequence info

[{"sequence":"MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":140,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P37840","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Cannot Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Alpha-synuclein often referred to by alternate names such as SNCA is a protein of around 14 kDa mass. It mainly expresses in the brain particularly in presynaptic nerve terminals. This protein functions mechanically by stabilizing synaptic vesicles and maintaining synaptic function. It exists both in soluble monomer forms and as aggregates in protein filaments. Antibodies like 4D6 and EP1536Y target monomer forms of protein for more detailed studies.
Biological function summary

The alpha-synuclein protein plays critical roles in neuronal activity. It contributes to neurotransmitter release regulation by acting in the formation and plasticity of the presynaptic neuronal network. Alpha-synuclein doesn't usually form parts of large protein complexes but it may associate transiently with membranes and vesicular structures. The protein's monomer form has also been observed in alpha lines and related neuronal processes operating alongside various cellular functions.

Pathways

Synaptic vesicle trafficking and dopamine neurotransmitter release are significant areas involving the alpha-synuclein protein. In these pathways alpha-synuclein interacts with other proteins like synaptophysin and protein monomer monomerizations are intrinsic to these processes. Altered function or aggregation of alpha-synuclein disrupts these pathways influencing broader neurological functions.

Alterations or accumulations of alpha-synuclein are strongly linked to Parkinson's disease and Lewy body dementia. In these conditions alpha-synuclein forms abnormal protein filaments known as Lewy bodies within neurons. These formations disrupt cellular processes and neuron health. Synucleinopathies such as these show connections with proteins like parkin and DJ-1 which also have key roles in these neurodegenerative diseases.

Specifications

Form

Lyophilized

Additional notes

Purity >95% by LC/MS

General info

Function

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (PubMed : 20798282, PubMed : 26442590, PubMed : 28288128, PubMed : 30404828). Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores (PubMed : 28288128, PubMed : 30404828). Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis (PubMed : 30404828). Also acts as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5 (PubMed : 20798282). This chaperone activity is important to sustain normal SNARE-complex assembly during aging (PubMed : 20798282). Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity (PubMed : 26442590).

Sequence similarities

Belongs to the synuclein family.

Post-translational modifications

Phosphorylated, predominantly on serine residues. Phosphorylation by CK1 appears to occur on residues distinct from the residue phosphorylated by other kinases. Phosphorylation of Ser-129 is selective and extensive in synucleinopathy lesions. In vitro, phosphorylation at Ser-129 promoted insoluble fibril formation. Phosphorylated on Tyr-125 by a PTK2B-dependent pathway upon osmotic stress.. Hallmark lesions of neurodegenerative synucleinopathies contain alpha-synuclein that is modified by nitration of tyrosine residues and possibly by dityrosine cross-linking to generated stable oligomers.. Ubiquitinated. The predominant conjugate is the diubiquitinated form.. Acetylation at Met-1 seems to be important for proper folding and native oligomeric structure.

Product protocols

Target data

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (PubMed : 20798282, PubMed : 26442590, PubMed : 28288128, PubMed : 30404828). Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores (PubMed : 28288128, PubMed : 30404828). Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis (PubMed : 30404828). Also acts as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5 (PubMed : 20798282). This chaperone activity is important to sustain normal SNARE-complex assembly during aging (PubMed : 20798282). Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity (PubMed : 26442590).
See full target information SNCA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com