JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB218818

Recombinant Human Alpha-synuclein protein monomer (Active)

Be the first to review this product! Submit a review

|

(5 Publications)

Recombinant Human Alpha-synuclein protein monomer (Active) is a Human Full Length SNCA protein, in the 1 to 140 aa range with >95% purity, < 5 EU/mL endotoxin level and suitable for western blot, Functional studies and SDS-PAGE. The predicted molecular weight of ab218818 recombinant protein is 14.5 kDa.

- Suitable for Thioflavin T Fluorescence assay
- Save time and ensure accurate results - use our recombinant Alpha-synuclein (SNCA) protein
- Optimal protein bioactivity, stability and reproducibility

View Alternative Names

NACP, PARK1, SNCA, Alpha-synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor

2 Images
Functional Studies - Recombinant Human Alpha-synuclein protein monomer (Active) (AB218818)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human Alpha-synuclein protein monomer (Active) (AB218818)

ThT emission curves show increased fluorescence (correlated to alpha-synuclein protein aggregation) over time when 10 μM of active alpha-synuclein aggregate (ab218819) is combined with 100 μM of active alpha-synuclein monomer (ab218818) (light blue), as compared to when 100 μM of control alpha-synuclein monomer (ab218816) is combined with 10 μM of active alpha-synuclein aggregate (ab218819) (dark blue).

ThT ex = 450 nm, em = 485 nm. View protocol.

SDS-PAGE - Recombinant Human Alpha-synuclein protein monomer (Active) (AB218818)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Alpha-synuclein protein monomer (Active) (AB218818)

SDS-PAGE of ~14 kDa Human Recombinant Alpha Synuclein Protein Monomer (SPR-321). Lane 1 : Molecular Weight Ladder (MW). Lane 2 : Alpha Synuclein Protein Monomer (2 µg) (SPR-321).

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 5 EU/mL

Expression system

Escherichia coli

Tags

Tag free

Applications

WB, SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

100 μM alpha synuclein protein monomer (ab218818), seeded with 10 μM alpha synuclein protein aggregate in 25 μM Thioflavin T (ab120751) (PBS pH 7.4, 100 μl reaction volume), generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours.

Fluorescence was measured by excitation at 450 nm and emission at 485 nm, on a Molecular Devices Gemini XPS microplate reader.

Endotoxin Level: < 5 EU/mL

Accession

P37840

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our Recombinant Human Alpha-synuclein (SCNA) protein monomer (Active) ab218818 as a control in western blot and SDS-PAGE.

Check out of western blot protocol for more information here

Protocol FAQ

Q: Do you have a recommended protocol for the Thioflavin T Fluorescence assay?
A: Please check our recommended Thioflavin T Fluorescence assay here

Sequence info

[{"sequence":"MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA","proteinLength":"Full Length","predictedMolecularWeight":"14.46 kDa","actualMolecularWeight":null,"aminoAcidEnd":140,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P37840","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Alpha-synuclein often referred to by alternate names such as SNCA is a protein of around 14 kDa mass. It mainly expresses in the brain particularly in presynaptic nerve terminals. This protein functions mechanically by stabilizing synaptic vesicles and maintaining synaptic function. It exists both in soluble monomer forms and as aggregates in protein filaments. Antibodies like 4D6 and EP1536Y target monomer forms of protein for more detailed studies.
Biological function summary

The alpha-synuclein protein plays critical roles in neuronal activity. It contributes to neurotransmitter release regulation by acting in the formation and plasticity of the presynaptic neuronal network. Alpha-synuclein doesn't usually form parts of large protein complexes but it may associate transiently with membranes and vesicular structures. The protein's monomer form has also been observed in alpha lines and related neuronal processes operating alongside various cellular functions.

Pathways

Synaptic vesicle trafficking and dopamine neurotransmitter release are significant areas involving the alpha-synuclein protein. In these pathways alpha-synuclein interacts with other proteins like synaptophysin and protein monomer monomerizations are intrinsic to these processes. Altered function or aggregation of alpha-synuclein disrupts these pathways influencing broader neurological functions.

Alterations or accumulations of alpha-synuclein are strongly linked to Parkinson's disease and Lewy body dementia. In these conditions alpha-synuclein forms abnormal protein filaments known as Lewy bodies within neurons. These formations disrupt cellular processes and neuron health. Synucleinopathies such as these show connections with proteins like parkin and DJ-1 which also have key roles in these neurodegenerative diseases.

Specifications

Form

Liquid

Additional notes

ab218818 is purified by ion exchange.

General info

Function

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (PubMed : 20798282, PubMed : 26442590, PubMed : 28288128, PubMed : 30404828). Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores (PubMed : 28288128, PubMed : 30404828). Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis (PubMed : 30404828). Also acts as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5 (PubMed : 20798282). This chaperone activity is important to sustain normal SNARE-complex assembly during aging (PubMed : 20798282). Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity (PubMed : 26442590).

Sequence similarities

Belongs to the synuclein family.

Post-translational modifications

Phosphorylated, predominantly on serine residues. Phosphorylation by CK1 appears to occur on residues distinct from the residue phosphorylated by other kinases. Phosphorylation of Ser-129 is selective and extensive in synucleinopathy lesions. In vitro, phosphorylation at Ser-129 promoted insoluble fibril formation. Phosphorylated on Tyr-125 by a PTK2B-dependent pathway upon osmotic stress.. Hallmark lesions of neurodegenerative synucleinopathies contain alpha-synuclein that is modified by nitration of tyrosine residues and possibly by dityrosine cross-linking to generated stable oligomers.. Ubiquitinated. The predominant conjugate is the diubiquitinated form.. Acetylation at Met-1 seems to be important for proper folding and native oligomeric structure.

Product protocols

Target data

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (PubMed : 20798282, PubMed : 26442590, PubMed : 28288128, PubMed : 30404828). Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores (PubMed : 28288128, PubMed : 30404828). Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis (PubMed : 30404828). Also acts as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5 (PubMed : 20798282). This chaperone activity is important to sustain normal SNARE-complex assembly during aging (PubMed : 20798282). Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity (PubMed : 26442590).
See full target information SNCA

Publications (5)

Recent publications for all applications. Explore the full list and refine your search

Biomedicines 13: PubMed39857706

2025

Novel Poly-Arginine Peptide R18D Reduces α-Synuclein Aggregation and Uptake of α-Synuclein Seeds in Cortical Neurons.

Applications

Unspecified application

Species

Unspecified reactive species

Emma C Robinson,Anastazja M Gorecki,Samuel R Pesce,Vaishali Bagda,Ryan S Anderton,Bruno P Meloni

Life science alliance 7: PubMed38609183

2024

Nr1h4 and Thrb ameliorate ER stress and provide protection in the MPTP mouse model of Parkinson's.

Applications

Unspecified application

Species

Unspecified reactive species

Nancy Ahuja,Shalini Gupta,Rashmi Arora,Ella Bhagyaraj,Drishti Tiwari,Sumit Kumar,Pawan Gupta

NPJ Parkinson's disease 8:115 PubMed36088364

2022

Long-term inhibition of mutant LRRK2 hyper-kinase activity reduced mouse brain α-synuclein oligomers without adverse effects.

Applications

Unspecified application

Species

Unspecified reactive species

Philip Wing-Lok Ho,Eunice Eun-Seo Chang,Chi-Ting Leung,Huifang Liu,Yasine Malki,Shirley Yin-Yu Pang,Zoe Yuen-Kiu Choi,Yingmin Liang,Weng Seng Lai,Yuefei Ruan,Kenneth Mei-Yee Leung,Susan Yung,Judith Choi-Wo Mak,Michelle Hiu-Wai Kung,David B Ramsden,Shu-Leong Ho

Biomolecules 12: PubMed35204664

2022

Spreading of Aggregated α-Synuclein in Sagittal Organotypic Mouse Brain Slices.

Applications

Unspecified application

Species

Unspecified reactive species

Buket Uçar,Nadia Stefanova,Christian Humpel

eNeuro 8: PubMed33229413

2020

α-Synuclein Aggregates Increase the Conductance of Substantia Nigra Dopamine Neurons, an Effect Partly Reversed by the KATP Channel Inhibitor Glibenclamide.

Applications

Unspecified application

Species

Unspecified reactive species

E Hill,R Gowers,M J E Richardson,M J Wall
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com