JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198474

Recombinant Human and Mouse Angiopoietin 1 + COMP/Cartilage oligomeric matrix protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human and Mouse Angiopoietin 1 + COMP/Cartilage oligomeric matrix protein is a Human Fragment protein, in the 28 to 72 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

KIAA0003, ANGPT1, Angiopoietin-1, ANG-1

1 Images
SDS-PAGE - Recombinant Human and Mouse Angiopoietin 1 + COMP/Cartilage oligomeric matrix protein (AB198474)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human and Mouse Angiopoietin 1 + COMP/Cartilage oligomeric matrix protein (AB198474)

SDS-PAGE analysis of ab198474.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q15389

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% Sorbitan monolaurate, ethoxylated, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACG","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":72,"aminoAcidStart":28,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9R0G6","tags":[]},{"sequence":"DTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":498,"aminoAcidStart":256,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q15389","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Angiopoietin 1 also known as COMP (Cartilage Oligomeric Matrix Protein) plays a significant role in the modulation of angiogenesis and vascular stability. This protein has a molecular mass of approximately 70 kDa. It is predominantly expressed in endothelial cells as well as in some other cell types such as pericytes and smooth muscle cells. COMP serves important roles in the extracellular matrix impacting the structural organization and regulation of various tissues.
Biological function summary

Angiopoietin 1 contributes to several essential processes like blood vessel maturation and stabilization. It functions by binding to the Tie2 receptor initiating a signaling cascade that prevents vascular leakage. Angiopoietin 1 exists as part of a complex that includes the receptor Tie2 and its interaction facilitates the maintenance of endothelial cells' quiescent state. This protein's action is important for maintaining a balanced environment in the vascular system.

Pathways

Angiopoietin 1 fits prominently into the angiopoietin-Tie signaling pathway playing its role in vascular development and maintenance. It also interplays significantly with the phosphoinositide 3-kinase (PI3K)-Akt signaling pathway influencing cell survival and proliferation. Through the Tie2 receptor Angiopoietin 1 aligns its function with proteins such as vascular endothelial growth factor (VEGF) modulating responses important for angiogenesis.

Angiopoietin 1 is linked to conditions like inflammation and cancer where vascular dynamics are disrupted. Alterations in Angiopoietin 1 expression can correlate with pathological states such as tumor growth. It connects with the protein Angiopoietin 2 (Ang-2) which often antagonizes Angiopoietin 1 influencing the balance between vessel stability and regression. Understanding the regulation and balance of Angiopoietin 1 and Angiopoietin 2 is critical in targeting therapeutic strategies for diseases influenced by vascular alterations.

Specifications

Form

Liquid

General info

Function

Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Required for normal angiogenesis and heart development during embryogenesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. Mediates blood vessel maturation/stability. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme.

Post-translational modifications

Glycosylated.

Product protocols

Target data

Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Required for normal angiogenesis and heart development during embryogenesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. Mediates blood vessel maturation/stability. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme.
See full target information ANGPT1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com