JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235857

Recombinant Human Androgen Receptor protein (Tagged)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Androgen Receptor protein (Tagged) is a Human Fragment protein in the 551 to 919 aa range with >90% purity and suitable for SDS-PAGE. The predicted molecular weight of ab235857 protein is 62.4 kDa.

- Save time and ensure accurate results - use our human androgen receptor (AR) protein as a control

View Alternative Names

DHTR, NR3C4, AR, Androgen receptor, Dihydrotestosterone receptor, Nuclear receptor subfamily 3 group C member 4

1 Images
SDS-PAGE - Recombinant Human Androgen Receptor protein (Tagged) (AB235857)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Androgen Receptor protein (Tagged) (AB235857)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235857.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

10x His tag N-Terminus SUMO tag N-Terminus Myc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P10275

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our recombinant human androgen receptor (AR) protein ab235857 as a control in SDS-PAGE.

Check out our protein gel staining guide for SDS-PAGE here.

Sequence info

[{"linker":null,"sequence":"DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT","proteinLength":"Fragment","predictedMolecularWeight":"62.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":919,"aminoAcidStart":551,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P10275","tags":[{"tag":"10x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"},{"tag":"Myc","terminus":"C-Terminus"}]}]

Properties and storage information

Form
Liquid
Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The androgen receptor (AR) also known as NR3C4 functions mechanically as a type of nuclear receptor that is activated by binding androgens including testosterone and dihydrotestosterone. The AR has a molecular weight of approximately 110 kDa. It is expressed in various tissues notably in the prostate skeletal muscle and certain areas of the brain. Within cells AR is usually located in the cytoplasm when unbound and translocates to the nucleus upon activation by its ligands.
Biological function summary

AR interacts with androgen hormones to regulate gene expression. It forms a complex with coactivators and corepressors to modulate transcription of target genes involved in male sexual development and reproductive function. AR plays an important role in the development and maintenance of male characteristics and reproductive activity. Its expression impacts cellular processes such as proliferation differentiation and apoptosis.

Pathways

AR is intricately involved in the androgen signaling pathway which affects the regulation of genes related to male sexual characteristics. It also plays a part in the PI3K/Akt pathway influencing cell growth and survival. The AR pathway interacts with proteins such as estrogen receptors to mediate cross-talk between hormonal pathways highlighting its broad biological impacts.

AR has a significant connection to prostate cancer where it drives tumor growth and progression. Mutations and overexpression of the androgen receptor are often observed in prostate cancer cells. Another condition linked to AR is androgen insensitivity syndrome where mutations in the AR gene result in partial or complete inability of cells to respond to androgenic hormones. In these conditions AR antagonists like bicalutamide are often used as treatment inhibiting the receptor's activity to manage disease progression.

General info

Function

Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues (PubMed : 19022849). Transcription factor activity is modulated by bound coactivator and corepressor proteins like ZBTB7A that recruits NCOR1 and NCOR2 to the androgen response elements/ARE on target genes, negatively regulating androgen receptor signaling and androgen-induced cell proliferation (PubMed : 20812024). Transcription activation is also down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3.. Isoform 3. Lacks the C-terminal ligand-binding domain and therefore constitutively regulates the transcription of a specific set of canonical AR-target genes, including PSA/KLK3 and TMPRSS2, independently of steroid hormones (PubMed : 19244107, PubMed : 25008967). However, some genes are differentially regulated by full-length AR (isoform 1) and isoform 3. Isoform 3-specific target genes may be regulated independently of FOXA1 expression (PubMed : 25008967).. Isoform 4. Lacks the C-terminal ligand-binding domain and may therefore constitutively activate the transcription of a specific set of genes independently of steroid hormones.

Sequence similarities

Belongs to the nuclear hormone receptor family. NR3 subfamily.

Post-translational modifications

Sumoylated on Lys-388 (major) and Lys-521. Ubiquitinated. Deubiquitinated by USP26. 'Lys-6' and 'Lys-27'-linked polyubiquitination by RNF6 modulates AR transcriptional activity and specificity.. Phosphorylated in prostate cancer cells in response to several growth factors including EGF. Phosphorylation is induced by c-Src kinase (CSK). Tyr-535 is one of the major phosphorylation sites and an increase in phosphorylation and Src kinase activity is associated with prostate cancer progression. Phosphorylation by TNK2 enhances the DNA-binding and transcriptional activity and may be responsible for androgen-independent progression of prostate cancer. Phosphorylation at Ser-83 by CDK9 regulates AR promoter selectivity and cell growth. Phosphorylation by PAK6 leads to AR-mediated transcription inhibition.. Palmitoylated by ZDHHC7 and ZDHHC21. Palmitoylation is required for plasma membrane targeting and for rapid intracellular signaling via ERK and AKT kinases and cAMP generation.

Product protocols

Target data

Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues (PubMed : 19022849). Transcription factor activity is modulated by bound coactivator and corepressor proteins like ZBTB7A that recruits NCOR1 and NCOR2 to the androgen response elements/ARE on target genes, negatively regulating androgen receptor signaling and androgen-induced cell proliferation (PubMed : 20812024). Transcription activation is also down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3.. Isoform 3. Lacks the C-terminal ligand-binding domain and therefore constitutively regulates the transcription of a specific set of canonical AR-target genes, including PSA/KLK3 and TMPRSS2, independently of steroid hormones (PubMed : 19244107, PubMed : 25008967). However, some genes are differentially regulated by full-length AR (isoform 1) and isoform 3. Isoform 3-specific target genes may be regulated independently of FOXA1 expression (PubMed : 25008967).. Isoform 4. Lacks the C-terminal ligand-binding domain and may therefore constitutively activate the transcription of a specific set of genes independently of steroid hormones.
See full target information AR

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Nature communications 14:5790 PubMed37737243

2023

A chemical catalyst enabling histone acylation with endogenous acyl-CoA.

Applications

Unspecified application

Species

Unspecified reactive species

Misuzu Habazaki,Shinsuke Mizumoto,Hidetoshi Kajino,Tomoya Kujirai,Hitoshi Kurumizaka,Shigehiro A Kawashima,Kenzo Yamatsugu,Motomu Kanai
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com