JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177677

Recombinant Human Angiogenin protein (denatured)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Angiogenin protein (denatured) is a Human Full Length protein, in the 25 to 147 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

RNASE5, ANG, Angiogenin, Ribonuclease 5, RNase 5

1 Images
SDS-PAGE - Recombinant Human Angiogenin protein (denatured) (AB177677)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Angiogenin protein (denatured) (AB177677)

15% SDS-PAGE analysis of ab177677 (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P03950

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

You may be interested in:

AB99970

Human Angiogenin ELISA Kit (ANG)

0

0 Reviews

View product

We recommend this product because it’s often used in the same experiment or related research.

We advise that you always check the datasheet to ensure it fits your experiments, or contact ourtechnical teamfor help.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP","proteinLength":"Full Length","predictedMolecularWeight":"16.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":147,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P03950","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Angiogenin also known as ANG is a small protein with a molecular mass of approximately 14 kDa. It belongs to the ribonuclease A superfamily. Angiogenin expression occurs in a variety of tissues with notably pronounced levels in the liver pancreas and placenta indicating its widespread biological importance. In addition to its primary name it appears in the context of research under alternative names like KIT ANG and elisa ang reflecting its use and identification in various experimental assays.
Biological function summary

Angiogenin significantly contributes to the process of angiogenesis the formation of new blood vessels from pre-existing vascular structures. It characterizes acts as both a ribonuclease and a potent angiogenic factor. Although not part of a multi-protein complex angiogenin interacts with endothelial cells to promote their growth and migration. Angiogenin facilitates these cellular behaviors by triggering pathways that enhance cell survival and proliferation essential for healthy tissue development and repair.

Pathways

Angiogenin is intricately involved in the angiogenesis pathway a critical process for both physiological and pathological conditions. It interacts with proteins such as VEGF (vascular endothelial growth factor) which plays an essential role in vascular function. Angiogenin's interaction with these pathways enhances cellular responses to external stimuli maintaining vascular integrity and supporting tissue regeneration under stress or injury conditions.

Angiogenin has connections to conditions like cancer and amyotrophic lateral sclerosis (ALS). Aberrant regulation of angiogenin can contribute to tumorigenesis by promoting excessive angiogenesis aiding the growth and spread of cancerous cells. In ALS altered angiogenin function associates with neurodegenerative processes linking its function to proteins such as superoxide dismutase 1 (SOD1). Understanding angiogenin's role in these diseases aids in uncovering therapeutic targets and developing treatment strategies.

Specifications

Form

Liquid

General info

Function

Secreted ribonuclease that can either promote or restrict cell proliferation of target cells, depending on the context (PubMed : 12051708, PubMed : 1400510, PubMed : 19332886, PubMed : 20129916, PubMed : 21855800, PubMed : 23047679, PubMed : 23843625, PubMed : 2424496, PubMed : 2459697, PubMed : 2730651, PubMed : 27518564, PubMed : 28176817, PubMed : 29100074, PubMed : 29748193, PubMed : 3122207, PubMed : 32510170, PubMed : 38718836, PubMed : 8159680, PubMed : 8570639, PubMed : 8622921, PubMed : 9578571). Endocytosed in target cells via its receptor PLXNB2 and translocates to the cytoplasm or nucleus (PubMed : 29100074, PubMed : 32510170). Under stress conditions, localizes to the cytoplasm and promotes the assembly of stress granules (SGs) : specifically cleaves a subset of tRNAs within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs), resulting in translation repression and inhibition of cell proliferation (PubMed : 1400510, PubMed : 19332886, PubMed : 20129916, PubMed : 21855800, PubMed : 23047679, PubMed : 27518564, PubMed : 29100074, PubMed : 29748193, PubMed : 32510170, PubMed : 38718836). tiRNas also prevent formation of apoptosome, thereby promoting cell survival (By similarity). Preferentially cleaves RNAs between a pyrimidine and an adenosine residue, suggesting that it cleaves the anticodon loop of tRNA(Ala) (32-UUAGCAU-38) after positions 33 and 36 (PubMed : 3289612, PubMed : 38718836). Cleaves a subset of tRNAs, including tRNA(Ala), tRNA(Glu), tRNA(Gly), tRNA(Lys), tRNA(Val), tRNA(His), tRNA(Asp) and tRNA(Sec) (PubMed : 31582561). Under growth conditions and in differentiated cells, translocates to the nucleus and stimulates ribosomal RNA (rRNA) transcription, including that containing the initiation site sequences of 45S rRNA, thereby promoting cell growth and proliferation (PubMed : 12051708, PubMed : 15735021, PubMed : 27518564, PubMed : 29100074, PubMed : 8127865). Angiogenin induces vascularization of normal and malignant tissues via its ability to promote rRNA transcription (PubMed : 19354288, PubMed : 4074709, PubMed : 8448182). Involved in hematopoietic stem and progenitor cell (HSPC) growth and survival by promoting rRNA transcription in growth conditions and inhibiting translation in response to stress, respectively (PubMed : 27518564). Mediates the crosstalk between myeloid and intestinal epithelial cells to protect the intestinal epithelial barrier integrity : secreted by myeloid cells and promotes intestinal epithelial cells proliferation and survival (PubMed : 32510170). Also mediates osteoclast-endothelial cell crosstalk in growing bone : produced by osteoclasts and protects the neighboring vascular cells against senescence by promoting rRNA transcription (By similarity).

Sequence similarities

Belongs to the pancreatic ribonuclease family.

Subcellular localisation

Nucleus

Product protocols

For this product, it's our understanding that no specific protocols are required. You can visit:

Target data

Secreted ribonuclease that can either promote or restrict cell proliferation of target cells, depending on the context (PubMed : 12051708, PubMed : 1400510, PubMed : 19332886, PubMed : 20129916, PubMed : 21855800, PubMed : 23047679, PubMed : 23843625, PubMed : 2424496, PubMed : 2459697, PubMed : 2730651, PubMed : 27518564, PubMed : 28176817, PubMed : 29100074, PubMed : 29748193, PubMed : 3122207, PubMed : 32510170, PubMed : 38718836, PubMed : 8159680, PubMed : 8570639, PubMed : 8622921, PubMed : 9578571). Endocytosed in target cells via its receptor PLXNB2 and translocates to the cytoplasm or nucleus (PubMed : 29100074, PubMed : 32510170). Under stress conditions, localizes to the cytoplasm and promotes the assembly of stress granules (SGs) : specifically cleaves a subset of tRNAs within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs), resulting in translation repression and inhibition of cell proliferation (PubMed : 1400510, PubMed : 19332886, PubMed : 20129916, PubMed : 21855800, PubMed : 23047679, PubMed : 27518564, PubMed : 29100074, PubMed : 29748193, PubMed : 32510170, PubMed : 38718836). tiRNas also prevent formation of apoptosome, thereby promoting cell survival (By similarity). Preferentially cleaves RNAs between a pyrimidine and an adenosine residue, suggesting that it cleaves the anticodon loop of tRNA(Ala) (32-UUAGCAU-38) after positions 33 and 36 (PubMed : 3289612, PubMed : 38718836). Cleaves a subset of tRNAs, including tRNA(Ala), tRNA(Glu), tRNA(Gly), tRNA(Lys), tRNA(Val), tRNA(His), tRNA(Asp) and tRNA(Sec) (PubMed : 31582561). Under growth conditions and in differentiated cells, translocates to the nucleus and stimulates ribosomal RNA (rRNA) transcription, including that containing the initiation site sequences of 45S rRNA, thereby promoting cell growth and proliferation (PubMed : 12051708, PubMed : 15735021, PubMed : 27518564, PubMed : 29100074, PubMed : 8127865). Angiogenin induces vascularization of normal and malignant tissues via its ability to promote rRNA transcription (PubMed : 19354288, PubMed : 4074709, PubMed : 8448182). Involved in hematopoietic stem and progenitor cell (HSPC) growth and survival by promoting rRNA transcription in growth conditions and inhibiting translation in response to stress, respectively (PubMed : 27518564). Mediates the crosstalk between myeloid and intestinal epithelial cells to protect the intestinal epithelial barrier integrity : secreted by myeloid cells and promotes intestinal epithelial cells proliferation and survival (PubMed : 32510170). Also mediates osteoclast-endothelial cell crosstalk in growing bone : produced by osteoclasts and protects the neighboring vascular cells against senescence by promoting rRNA transcription (By similarity).
See full target information ANG

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Associated Products

Select an associated product type
Alternative Product
Proteins & Peptides

AB151351

Recombinant Human Angiogenin protein

proteins-peptides

recombinant-human-angiogenin-protein-ab151351

0

(0 reviews)

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com