JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB157870

Recombinant Human Angiotensin II Type 1 Receptor protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Angiotensin II Type 1 Receptor protein (GST tag N-Terminus) is a Human Fragment protein, in the 250 to 359 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

AGTR1A, AGTR1B, AT2R1, AT2R1B, AGTR1, Type-1 angiotensin II receptor, AT1AR, AT1BR, Angiotensin II type-1 receptor, AT1 receptor

1 Images
SDS-PAGE - Recombinant Human Angiotensin II Type 1 Receptor protein (GST tag N-Terminus) (AB157870)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Angiotensin II Type 1 Receptor protein (GST tag N-Terminus) (AB157870)

ab157870 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P30556

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"FFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":359,"aminoAcidStart":250,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P30556","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Angiotensin II Type 1 Receptor also known as AGTR1 AT1 receptor or Angiotensin Receptor 1 is a G protein-coupled receptor with a mass of approximately 45 kDa. This receptor binds to the angiotensin II peptide playing a central role in regulating blood pressure. It is broadly expressed in tissues such as vascular smooth muscle cells cardiac myocytes kidneys and brain. The AT1 receptor mediates vasoconstriction aldosterone secretion and cellular growth through its interaction with angiotensin II impacting cardiovascular functions.
Biological function summary

The Angiotensin II Type 1 Receptor contributes significantly to the regulation of cardiovascular homeostasis. It forms part of a complex signaling system involving G proteins phospholipase C and other downstream effectors. This receptor elicits responses important for maintaining vascular tone and fluid balance. By activating intracellular signaling cascade it plays an essential role in sodium reabsorption and systemic blood pressure maintenance. The receptor's expression and activity represent an important component in cardiovascular function.

Pathways

The AT1 receptor participates actively in the renin-angiotensin system (RAS) and is a significant player in the regulation of blood pressure. It interacts with angiotensin converting enzyme (ACE) and angiotensin II within this pathway. Additionally the receptor is linked to the mitogen-activated protein kinase (MAPK) pathway which further influences cell proliferation and vascular remodeling. These interactions highlight the receptor's involvement in vascular smooth muscle cell function and the broader implications for cardiovascular health.

The Angiotensin II Type 1 Receptor is closely associated with conditions such as hypertension and heart failure. Dysfunction or overactivity of this receptor contributes to elevated blood pressure and compromised cardiac function. The AT1 receptor's connection to ACE highlights its therapeutic relevance as many antihypertensive treatments target this interaction. By modulating the receptor's activity these treatments aim to alleviate symptoms and reduce the risk of cardiovascular events.

Specifications

Form

Liquid

General info

Function

Receptor for angiotensin II, a vasoconstricting peptide, which acts as a key regulator of blood pressure and sodium retention by the kidney (PubMed : 15611106, PubMed : 1567413, PubMed : 25913193, PubMed : 26420482, PubMed : 30639100, PubMed : 32079768, PubMed : 8987975). The activated receptor in turn couples to G-alpha proteins G(q) (GNAQ, GNA11, GNA14 or GNA15) and thus activates phospholipase C and increases the cytosolic Ca(2+) concentrations, which in turn triggers cellular responses such as stimulation of protein kinase C (PubMed : 15611106).. (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, it is able to recognize and internalize the complex formed by secreted ACE2 and SARS-CoV-2 spike protein through DNM2/dynamin 2-dependent endocytosis.

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Post-translational modifications

C-terminal Ser or Thr residues may be phosphorylated.

Product protocols

Target data

Receptor for angiotensin II, a vasoconstricting peptide, which acts as a key regulator of blood pressure and sodium retention by the kidney (PubMed : 15611106, PubMed : 1567413, PubMed : 25913193, PubMed : 26420482, PubMed : 30639100, PubMed : 32079768, PubMed : 8987975). The activated receptor in turn couples to G-alpha proteins G(q) (GNAQ, GNA11, GNA14 or GNA15) and thus activates phospholipase C and increases the cytosolic Ca(2+) concentrations, which in turn triggers cellular responses such as stimulation of protein kinase C (PubMed : 15611106).. (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, it is able to recognize and internalize the complex formed by secreted ACE2 and SARS-CoV-2 spike protein through DNM2/dynamin 2-dependent endocytosis.
See full target information AGTR1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

American journal of physiology. Renal physiology 313:F440-F449 PubMed28468964

2017

Luminal ANG II is internalized as a complex with ATR/ATR heterodimers to target endoplasmic reticulum in LLC-PK cells.

Applications

Unspecified application

Species

Unspecified reactive species

Fernanda M Ferrão,Luiza H D Cardoso,Heather A Drummond,Xiao C Li,Jia L Zhuo,Dayene S Gomes,Lucienne S Lara,Adalberto Vieyra,Jennifer Lowe
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com