JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB176028

Recombinant human ANGPTL3 protein

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant human ANGPTL3 protein is a Human Full Length protein, in the 17 to 460 aa range, expressed in CHO cells, with >98%, < 1 EU/µg endotoxin level, suitable for ELISA, HPLC, SDS-PAGE, FuncS.

View Alternative Names

ANGPT5, UNQ153/PRO179, ANGPTL3, Angiopoietin-related protein 3, Angiopoietin-5, Angiopoietin-like protein 3, ANG-5

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

CHO cells

Tags

His tag C-Terminus

Applications

ELISA, SDS-PAGE, FuncS, HPLC

applications

Biologically active

Yes

Biological activity

Measured by binding ability to recombinant αvβ3 integrin in a functional ELISA

Accession

Q9Y5C1

Animal free

No

Carrier free

Yes

Species

Human

Storage buffer

Constituents: 0.14% Sodium phosphate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Migrates by SDS-PAGE analysis at an apparent molecular weight of 62 kDa.</p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"53 kDa","actualMolecularWeight":null,"aminoAcidEnd":460,"aminoAcidStart":17,"nature":"Recombinant","expressionSystem":"CHO cells","accessionNumber":"Q9Y5C1","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
A few weeks
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon reconstitution add a carrier protein (0.1% BSA)
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ANGPTL3 also known as angiopoietin-like protein 3 or betatrophin is a protein that functions mechanistically in lipid metabolism. It consists of approximately 70 kDa mass and is expressed mainly in the liver. ANGPTL3 is synthesized and secreted as a glycoprotein and it undergoes post-translational modifications important for its function. The protein exists predominantly in a monomeric form in circulation.
Biological function summary

ANGPTL3 inhibits lipoprotein lipase (LPL) activity to regulate plasma lipid levels. It independently interacts with lipids and facilitates the storage of triglycerides making it an important modulator of lipid metabolism. ANGPTL3 does not form a stable complex with other proteins but modulates the presence and stability of LPL on the endothelial surface reducing lipid clearance. ANGPT1 ELISA can measure ANGPTL3 levels as part of routine assays including ANGPTL3 ELISA and beta-trophin ELISA.

Pathways

ANGPTL3 plays a central role in the lipid metabolism and energy homeostasis pathways. In the lipid metabolism pathway ANGPTL3's ability to inhibit LPL links it to other proteins involved in lipid transport and storage such as LDL and HDL particles. Another related protein ANGPTL4 shares similar functions with ANGPTL3 indicating a level of redundancy and regulation within these pathways. ANGPTL3 like ANGPTL4 is a significant player in balancing lipid processing and storage.

ANGPTL3 strongly associates with hyperlipidemia and atherosclerosis. Abnormalities in ANGPTL3 levels can lead to altered lipid profiles raising the risk for cardiovascular diseases. Familial combined hypolipidemia involves mutations in the ANGPTL3 gene leading to drastically lower lipid levels. Disorders such as hypercholesterolemia also demonstrate connections with ANGPTL3 highlighting its role in lipid imbalance. These associations make the anti-ANGPTL3 antibodies important for the study and treatment of such lipid disorders.

Specifications

Form

Lyophilized

General info

Function

Acts in part as a hepatokine that is involved in regulation of lipid and glucose metabolism (PubMed : 11788823, PubMed : 12909640, PubMed : 23661675, PubMed : 25495645). Proposed to play a role in the trafficking of energy substrates to either storage or oxidative tissues in response to food intake (By similarity). Has a stimulatory effect on plasma triglycerides (TG), which is achieved by suppressing plasma TG clearance via inhibition of LPL activity. The inhibition of LPL activity appears to be an indirect mechanism involving recruitment of proprotein convertases PCSK6 and FURIN to LPL leading to cleavage and dissociation of LPL from the cell surface; the function does not require ANGPTL3 proteolytic cleavage but seems to be mediated by the N-terminal domain, and is not inhibited by GPIHBP1 (PubMed : 12097324, PubMed : 19318355, PubMed : 20581395). Can inhibit endothelial lipase, causing increased plasma levels of high density lipoprotein (HDL) cholesterol and phospholipids (PubMed : 17110602, PubMed : 19028676). Can bind to adipocytes to activate lipolysis, releasing free fatty acids and glycerol (PubMed : 12565906). Suppresses LPL specifically in oxidative tissues which is required to route very low density lipoprotein (VLDL)-TG to white adipose tissue (WAT) for storage in response to food; the function may involve cooperation with circulating, liver-derived ANGPTL8 and ANGPTL4 expression in WAT (By similarity). Contributes to lower plasma levels of low density lipoprotein (LDL)-cholesterol by a mechanism that is independent of the canonical pathway implicating APOE and LDLR. May stimulate hypothalamic LPL activity (By similarity).. ANGPTL3(17-221). In vitro inhibits LPL activity; not effective on GPIHBP1-stabilized LPL.. Involved in angiogenesis. Binds to endothelial cells via integrin alpha-V/beta-3 (ITGAV : ITGB3), activates FAK, MAPK and Akt signaling pathways and induces cell adhesion and cell migration (PubMed : 11877390). Secreted from podocytes, may modulate properties of glomerular endothelial cells involving integrin alpha-V/beta-3 and Akt signaling (PubMed : 18535744). May increase the motility of podocytes. May induce actin filament rearrangements in podocytes implicating integrin alpha-V/beta-3 and Rac1 activation. Binds to hematopoietic stem cells (HSC) and is involved in the regulation of HSC activity probably implicating down-regulation of IKZF1/IKAROS (By similarity).

Post-translational modifications

O-glycosylated at Thr-226 by GALNT2; blocks processing and activation by proprotein convertases.. In part proteolytically cleaved by proprotein convertases; proposed to be involved in activation.

Product protocols

Target data

Acts in part as a hepatokine that is involved in regulation of lipid and glucose metabolism (PubMed : 11788823, PubMed : 12909640, PubMed : 23661675, PubMed : 25495645). Proposed to play a role in the trafficking of energy substrates to either storage or oxidative tissues in response to food intake (By similarity). Has a stimulatory effect on plasma triglycerides (TG), which is achieved by suppressing plasma TG clearance via inhibition of LPL activity. The inhibition of LPL activity appears to be an indirect mechanism involving recruitment of proprotein convertases PCSK6 and FURIN to LPL leading to cleavage and dissociation of LPL from the cell surface; the function does not require ANGPTL3 proteolytic cleavage but seems to be mediated by the N-terminal domain, and is not inhibited by GPIHBP1 (PubMed : 12097324, PubMed : 19318355, PubMed : 20581395). Can inhibit endothelial lipase, causing increased plasma levels of high density lipoprotein (HDL) cholesterol and phospholipids (PubMed : 17110602, PubMed : 19028676). Can bind to adipocytes to activate lipolysis, releasing free fatty acids and glycerol (PubMed : 12565906). Suppresses LPL specifically in oxidative tissues which is required to route very low density lipoprotein (VLDL)-TG to white adipose tissue (WAT) for storage in response to food; the function may involve cooperation with circulating, liver-derived ANGPTL8 and ANGPTL4 expression in WAT (By similarity). Contributes to lower plasma levels of low density lipoprotein (LDL)-cholesterol by a mechanism that is independent of the canonical pathway implicating APOE and LDLR. May stimulate hypothalamic LPL activity (By similarity).. ANGPTL3(17-221). In vitro inhibits LPL activity; not effective on GPIHBP1-stabilized LPL.. Involved in angiogenesis. Binds to endothelial cells via integrin alpha-V/beta-3 (ITGAV : ITGB3), activates FAK, MAPK and Akt signaling pathways and induces cell adhesion and cell migration (PubMed : 11877390). Secreted from podocytes, may modulate properties of glomerular endothelial cells involving integrin alpha-V/beta-3 and Akt signaling (PubMed : 18535744). May increase the motility of podocytes. May induce actin filament rearrangements in podocytes implicating integrin alpha-V/beta-3 and Rac1 activation. Binds to hematopoietic stem cells (HSC) and is involved in the regulation of HSC activity probably implicating down-regulation of IKZF1/IKAROS (By similarity).
See full target information ANGPTL3

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Biochemical and biophysical research communication 516:880-887 PubMed31270029

2019

ANGPTL3 inhibits renal cell carcinoma metastasis by inhibiting VASP phosphorylation.

Applications

Unspecified application

Species

Unspecified reactive species

Tangliang Zhao,Xiaolong Liang,Junming Chen,Yi Bao,Anbang Wang,Xinxin Gan,Xin Lu,Linhui Wang

British journal of cancer 119:450-461 PubMed30033448

2018

Angiopoietin-like protein 3 blocks nuclear import of FAK and contributes to sorafenib response.

Applications

Unspecified application

Species

Unspecified reactive species

Yi Bao,Fu Yang,Bing Liu,Tangliang Zhao,Zhipeng Xu,Ying Xiong,Shuhan Sun,Le Qu,Linhui Wang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com