JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271363

Recombinant human ANGPTL3 protein (DDDDK tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human ANGPTL3 protein (DDDDK tag C-Terminus) is a Human Full Length protein, in the 1 to 460 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

ANGPT5, UNQ153/PRO179, ANGPTL3, Angiopoietin-related protein 3, Angiopoietin-5, Angiopoietin-like protein 3, ANG-5

2 Images
Biological Activity - Recombinant human ANGPTL3 protein (DDDDK tag C-Terminus) (AB271363)
  • Biological Activity

Supplier Data

Biological Activity - Recombinant human ANGPTL3 protein (DDDDK tag C-Terminus) (AB271363)

Biological activity of ab271363.

ANGPTL3 activity was confirmed by treating THP-1 cells with 500 ng/ml of ANGPTL3 for 15 min, 30 min, 2 hr, or 4 hr. Phosphorylated-Erk was measured by Western blot and compared to total Erk levels.

SDS-PAGE - Recombinant human ANGPTL3 protein (DDDDK tag C-Terminus) (AB271363)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human ANGPTL3 protein (DDDDK tag C-Terminus) (AB271363)

SDS-PAGE analysis of ab271363.

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

DDDDK tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

ANGPTL3 activity was confirmed by treating THP-1 cells with 500 ng/ml of ANGPTL3 for 15 min, 30 min, 2 hr, or 4 hr. Phosphorylated-Erk was measured by Western blot and compared to total Erk levels.

Accession

Q9Y5C1

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in water

Storage buffer

pH: 7.4 Constituents: 0.58% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":"52.8 kDa","aminoAcidEnd":460,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9Y5C1","tags":[{"tag":"DDDDK","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon reconstitution add a carrier protein (0.1% BSA)
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ANGPTL3 also known as angiopoietin-like protein 3 or betatrophin is a protein that functions mechanistically in lipid metabolism. It consists of approximately 70 kDa mass and is expressed mainly in the liver. ANGPTL3 is synthesized and secreted as a glycoprotein and it undergoes post-translational modifications important for its function. The protein exists predominantly in a monomeric form in circulation.
Biological function summary

ANGPTL3 inhibits lipoprotein lipase (LPL) activity to regulate plasma lipid levels. It independently interacts with lipids and facilitates the storage of triglycerides making it an important modulator of lipid metabolism. ANGPTL3 does not form a stable complex with other proteins but modulates the presence and stability of LPL on the endothelial surface reducing lipid clearance. ANGPT1 ELISA can measure ANGPTL3 levels as part of routine assays including ANGPTL3 ELISA and beta-trophin ELISA.

Pathways

ANGPTL3 plays a central role in the lipid metabolism and energy homeostasis pathways. In the lipid metabolism pathway ANGPTL3's ability to inhibit LPL links it to other proteins involved in lipid transport and storage such as LDL and HDL particles. Another related protein ANGPTL4 shares similar functions with ANGPTL3 indicating a level of redundancy and regulation within these pathways. ANGPTL3 like ANGPTL4 is a significant player in balancing lipid processing and storage.

ANGPTL3 strongly associates with hyperlipidemia and atherosclerosis. Abnormalities in ANGPTL3 levels can lead to altered lipid profiles raising the risk for cardiovascular diseases. Familial combined hypolipidemia involves mutations in the ANGPTL3 gene leading to drastically lower lipid levels. Disorders such as hypercholesterolemia also demonstrate connections with ANGPTL3 highlighting its role in lipid imbalance. These associations make the anti-ANGPTL3 antibodies important for the study and treatment of such lipid disorders.

Specifications

Form

Lyophilized

General info

Function

Acts in part as a hepatokine that is involved in regulation of lipid and glucose metabolism (PubMed : 11788823, PubMed : 12909640, PubMed : 23661675, PubMed : 25495645). Proposed to play a role in the trafficking of energy substrates to either storage or oxidative tissues in response to food intake (By similarity). Has a stimulatory effect on plasma triglycerides (TG), which is achieved by suppressing plasma TG clearance via inhibition of LPL activity. The inhibition of LPL activity appears to be an indirect mechanism involving recruitment of proprotein convertases PCSK6 and FURIN to LPL leading to cleavage and dissociation of LPL from the cell surface; the function does not require ANGPTL3 proteolytic cleavage but seems to be mediated by the N-terminal domain, and is not inhibited by GPIHBP1 (PubMed : 12097324, PubMed : 19318355, PubMed : 20581395). Can inhibit endothelial lipase, causing increased plasma levels of high density lipoprotein (HDL) cholesterol and phospholipids (PubMed : 17110602, PubMed : 19028676). Can bind to adipocytes to activate lipolysis, releasing free fatty acids and glycerol (PubMed : 12565906). Suppresses LPL specifically in oxidative tissues which is required to route very low density lipoprotein (VLDL)-TG to white adipose tissue (WAT) for storage in response to food; the function may involve cooperation with circulating, liver-derived ANGPTL8 and ANGPTL4 expression in WAT (By similarity). Contributes to lower plasma levels of low density lipoprotein (LDL)-cholesterol by a mechanism that is independent of the canonical pathway implicating APOE and LDLR. May stimulate hypothalamic LPL activity (By similarity).. ANGPTL3(17-221). In vitro inhibits LPL activity; not effective on GPIHBP1-stabilized LPL.. Involved in angiogenesis. Binds to endothelial cells via integrin alpha-V/beta-3 (ITGAV : ITGB3), activates FAK, MAPK and Akt signaling pathways and induces cell adhesion and cell migration (PubMed : 11877390). Secreted from podocytes, may modulate properties of glomerular endothelial cells involving integrin alpha-V/beta-3 and Akt signaling (PubMed : 18535744). May increase the motility of podocytes. May induce actin filament rearrangements in podocytes implicating integrin alpha-V/beta-3 and Rac1 activation. Binds to hematopoietic stem cells (HSC) and is involved in the regulation of HSC activity probably implicating down-regulation of IKZF1/IKAROS (By similarity).

Post-translational modifications

O-glycosylated at Thr-226 by GALNT2; blocks processing and activation by proprotein convertases.. In part proteolytically cleaved by proprotein convertases; proposed to be involved in activation.

Product protocols

Target data

Acts in part as a hepatokine that is involved in regulation of lipid and glucose metabolism (PubMed : 11788823, PubMed : 12909640, PubMed : 23661675, PubMed : 25495645). Proposed to play a role in the trafficking of energy substrates to either storage or oxidative tissues in response to food intake (By similarity). Has a stimulatory effect on plasma triglycerides (TG), which is achieved by suppressing plasma TG clearance via inhibition of LPL activity. The inhibition of LPL activity appears to be an indirect mechanism involving recruitment of proprotein convertases PCSK6 and FURIN to LPL leading to cleavage and dissociation of LPL from the cell surface; the function does not require ANGPTL3 proteolytic cleavage but seems to be mediated by the N-terminal domain, and is not inhibited by GPIHBP1 (PubMed : 12097324, PubMed : 19318355, PubMed : 20581395). Can inhibit endothelial lipase, causing increased plasma levels of high density lipoprotein (HDL) cholesterol and phospholipids (PubMed : 17110602, PubMed : 19028676). Can bind to adipocytes to activate lipolysis, releasing free fatty acids and glycerol (PubMed : 12565906). Suppresses LPL specifically in oxidative tissues which is required to route very low density lipoprotein (VLDL)-TG to white adipose tissue (WAT) for storage in response to food; the function may involve cooperation with circulating, liver-derived ANGPTL8 and ANGPTL4 expression in WAT (By similarity). Contributes to lower plasma levels of low density lipoprotein (LDL)-cholesterol by a mechanism that is independent of the canonical pathway implicating APOE and LDLR. May stimulate hypothalamic LPL activity (By similarity).. ANGPTL3(17-221). In vitro inhibits LPL activity; not effective on GPIHBP1-stabilized LPL.. Involved in angiogenesis. Binds to endothelial cells via integrin alpha-V/beta-3 (ITGAV : ITGB3), activates FAK, MAPK and Akt signaling pathways and induces cell adhesion and cell migration (PubMed : 11877390). Secreted from podocytes, may modulate properties of glomerular endothelial cells involving integrin alpha-V/beta-3 and Akt signaling (PubMed : 18535744). May increase the motility of podocytes. May induce actin filament rearrangements in podocytes implicating integrin alpha-V/beta-3 and Rac1 activation. Binds to hematopoietic stem cells (HSC) and is involved in the regulation of HSC activity probably implicating down-regulation of IKZF1/IKAROS (By similarity).
See full target information ANGPTL3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com